Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | ACB354_RS02090 | Genome accession | NZ_CP167004 |
| Coordinates | 369291..369473 (+) | Length | 60 a.a. |
| NCBI ID | WP_011184907.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain Isolate 28 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 325756..372515 | 369291..369473 | within | 0 |
Gene organization within MGE regions
Location: 325756..372515
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACB354_RS01730 (ACB354_01730) | - | 325756..326910 (-) | 1155 | WP_023078039.1 | site-specific integrase | - |
| ACB354_RS01735 (ACB354_01735) | - | 327025..327447 (-) | 423 | WP_021340646.1 | Ltp family lipoprotein | - |
| ACB354_RS01740 (ACB354_01740) | - | 327519..328259 (-) | 741 | WP_021340648.1 | XRE family transcriptional regulator | - |
| ACB354_RS01745 (ACB354_01745) | - | 328619..328768 (+) | 150 | WP_021340643.1 | hypothetical protein | - |
| ACB354_RS01750 (ACB354_01750) | - | 328754..328969 (-) | 216 | WP_014635530.1 | hypothetical protein | - |
| ACB354_RS01755 (ACB354_01755) | - | 329028..329186 (+) | 159 | WP_021340638.1 | hypothetical protein | - |
| ACB354_RS01760 (ACB354_01760) | - | 329285..329926 (-) | 642 | WP_001008979.1 | hypothetical protein | - |
| ACB354_RS01765 (ACB354_01765) | - | 330019..330234 (+) | 216 | WP_000164463.1 | helix-turn-helix transcriptional regulator | - |
| ACB354_RS01770 (ACB354_01770) | - | 330382..330588 (+) | 207 | WP_021733331.1 | hypothetical protein | - |
| ACB354_RS01775 (ACB354_01775) | - | 330607..330948 (+) | 342 | WP_021340657.1 | hypothetical protein | - |
| ACB354_RS01780 (ACB354_01780) | - | 330906..331127 (-) | 222 | WP_002992762.1 | hypothetical protein | - |
| ACB354_RS01785 (ACB354_01785) | - | 331271..331456 (+) | 186 | WP_021340658.1 | helix-turn-helix domain-containing protein | - |
| ACB354_RS01790 (ACB354_01790) | - | 331534..331791 (+) | 258 | WP_001191791.1 | hypothetical protein | - |
| ACB354_RS01795 (ACB354_01795) | - | 331821..331961 (+) | 141 | WP_021340647.1 | hypothetical protein | - |
| ACB354_RS01800 (ACB354_01800) | - | 332089..332268 (+) | 180 | WP_012560974.1 | hypothetical protein | - |
| ACB354_RS01805 (ACB354_01805) | - | 332441..332713 (+) | 273 | WP_000370473.1 | hypothetical protein | - |
| ACB354_RS01810 (ACB354_01810) | - | 332703..333083 (-) | 381 | WP_000568478.1 | hypothetical protein | - |
| ACB354_RS01815 (ACB354_01815) | - | 333139..333582 (+) | 444 | WP_012560973.1 | hypothetical protein | - |
| ACB354_RS01820 (ACB354_01820) | - | 333698..334501 (+) | 804 | WP_021340639.1 | DnaD domain protein | - |
| ACB354_RS01825 (ACB354_01825) | - | 334488..335270 (+) | 783 | WP_021340659.1 | ATP-binding protein | - |
| ACB354_RS01830 (ACB354_01830) | - | 335261..335398 (+) | 138 | WP_011285580.1 | hypothetical protein | - |
| ACB354_RS01835 (ACB354_01835) | - | 335411..335764 (+) | 354 | WP_011285579.1 | hypothetical protein | - |
| ACB354_RS01840 (ACB354_01840) | - | 335745..335999 (+) | 255 | WP_011018143.1 | hypothetical protein | - |
| ACB354_RS01845 (ACB354_01845) | - | 336021..336503 (+) | 483 | WP_011018142.1 | siphovirus Gp157 family protein | - |
| ACB354_RS01850 (ACB354_01850) | - | 336504..337178 (+) | 675 | WP_021340321.1 | ERF family protein | - |
| ACB354_RS01855 (ACB354_01855) | ssbA | 337171..337590 (+) | 420 | WP_021340323.1 | single-stranded DNA-binding protein | Machinery gene |
| ACB354_RS01860 (ACB354_01860) | - | 337596..337799 (+) | 204 | WP_011106686.1 | hypothetical protein | - |
| ACB354_RS01865 (ACB354_01865) | - | 337799..338239 (+) | 441 | WP_011285574.1 | RusA family crossover junction endodeoxyribonuclease | - |
| ACB354_RS01870 (ACB354_01870) | - | 338236..338592 (+) | 357 | WP_023078113.1 | hypothetical protein | - |
| ACB354_RS01875 (ACB354_01875) | - | 338589..338840 (+) | 252 | WP_032462267.1 | hypothetical protein | - |
| ACB354_RS01880 (ACB354_01880) | - | 338834..339118 (+) | 285 | WP_020905119.1 | DUF3310 domain-containing protein | - |
| ACB354_RS01885 (ACB354_01885) | - | 339115..339384 (+) | 270 | WP_011054754.1 | hypothetical protein | - |
| ACB354_RS01890 (ACB354_01890) | - | 339394..339807 (+) | 414 | WP_021340433.1 | YopX family protein | - |
| ACB354_RS01895 (ACB354_01895) | - | 339804..339974 (+) | 171 | WP_002986866.1 | hypothetical protein | - |
| ACB354_RS01900 (ACB354_01900) | - | 339971..340135 (+) | 165 | WP_002986864.1 | hypothetical protein | - |
| ACB354_RS01905 (ACB354_01905) | - | 340132..340416 (+) | 285 | WP_021733928.1 | hypothetical protein | - |
| ACB354_RS01910 (ACB354_01910) | - | 340420..340902 (+) | 483 | WP_011017571.1 | class I SAM-dependent methyltransferase | - |
| ACB354_RS01915 (ACB354_01915) | - | 340892..341656 (+) | 765 | WP_023077953.1 | site-specific DNA-methyltransferase | - |
| ACB354_RS01920 (ACB354_01920) | - | 341704..341997 (+) | 294 | WP_032460172.1 | hypothetical protein | - |
| ACB354_RS01925 (ACB354_01925) | - | 342362..342799 (+) | 438 | WP_021340586.1 | DUF1492 domain-containing protein | - |
| ACB354_RS01930 (ACB354_01930) | - | 343658..344140 (+) | 483 | WP_002990047.1 | terminase small subunit | - |
| ACB354_RS01935 (ACB354_01935) | - | 344118..345407 (+) | 1290 | WP_021340182.1 | PBSX family phage terminase large subunit | - |
| ACB354_RS01940 (ACB354_01940) | - | 345419..346921 (+) | 1503 | WP_011184920.1 | phage portal protein | - |
| ACB354_RS01945 (ACB354_01945) | - | 346902..347915 (+) | 1014 | WP_011184919.1 | phage head morphogenesis protein | - |
| ACB354_RS01950 (ACB354_01950) | - | 347860..348465 (+) | 606 | WP_011184918.1 | ADP-ribosyltransferase | - |
| ACB354_RS01955 (ACB354_01955) | - | 348469..348654 (+) | 186 | WP_002988389.1 | hypothetical protein | - |
| ACB354_RS01960 (ACB354_01960) | - | 348725..348952 (+) | 228 | WP_021340177.1 | hypothetical protein | - |
| ACB354_RS01965 (ACB354_01965) | - | 348949..349230 (+) | 282 | WP_021340176.1 | hypothetical protein | - |
| ACB354_RS01970 (ACB354_01970) | - | 349394..350014 (+) | 621 | WP_023077275.1 | DUF4355 domain-containing protein | - |
| ACB354_RS01975 (ACB354_01975) | - | 350024..350392 (+) | 369 | WP_021733109.1 | hypothetical protein | - |
| ACB354_RS01980 (ACB354_01980) | - | 350395..351477 (+) | 1083 | WP_021733118.1 | major capsid protein | - |
| ACB354_RS01985 (ACB354_01985) | - | 351487..351729 (+) | 243 | WP_002988409.1 | HeH/LEM domain-containing protein | - |
| ACB354_RS01990 (ACB354_01990) | - | 351743..352096 (+) | 354 | WP_002988412.1 | phage head-tail connector protein | - |
| ACB354_RS01995 (ACB354_01995) | - | 352093..352401 (+) | 309 | WP_002988415.1 | hypothetical protein | - |
| ACB354_RS02000 (ACB354_02000) | - | 352382..352747 (+) | 366 | WP_002988417.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| ACB354_RS02005 (ACB354_02005) | - | 352744..353133 (+) | 390 | WP_021340184.1 | hypothetical protein | - |
| ACB354_RS02010 (ACB354_02010) | - | 353203..353767 (+) | 565 | Protein_343 | phage major tail protein, TP901-1 family | - |
| ACB354_RS02015 (ACB354_02015) | - | 353819..354178 (+) | 360 | WP_011184916.1 | tail assembly chaperone | - |
| ACB354_RS02020 (ACB354_02020) | - | 354220..354549 (+) | 330 | WP_002988428.1 | hypothetical protein | - |
| ACB354_RS02025 (ACB354_02025) | - | 354564..358199 (+) | 3636 | WP_011184915.1 | tape measure protein | - |
| ACB354_RS02030 (ACB354_02030) | - | 358231..359010 (+) | 780 | WP_011184914.1 | distal tail protein Dit | - |
| ACB354_RS02035 (ACB354_02035) | - | 359007..361058 (+) | 2052 | WP_011184913.1 | phage tail spike protein | - |
| ACB354_RS02040 (ACB354_02040) | hylP | 361055..362071 (+) | 1017 | WP_371399118.1 | hyaluronidase HylP | - |
| ACB354_RS02045 (ACB354_02045) | - | 362086..364101 (+) | 2016 | WP_371399119.1 | gp58-like family protein | - |
| ACB354_RS02050 (ACB354_02050) | - | 364113..364550 (+) | 438 | WP_011106643.1 | DUF1617 family protein | - |
| ACB354_RS02055 (ACB354_02055) | - | 364547..365164 (+) | 618 | WP_011184056.1 | DUF1366 domain-containing protein | - |
| ACB354_RS02060 (ACB354_02060) | - | 365174..365446 (+) | 273 | WP_002986916.1 | hypothetical protein | - |
| ACB354_RS02065 (ACB354_02065) | - | 365443..365670 (+) | 228 | WP_000609113.1 | phage holin | - |
| ACB354_RS02070 (ACB354_02070) | - | 365792..366544 (+) | 753 | WP_011184910.1 | CHAP domain-containing protein | - |
| ACB354_RS02075 (ACB354_02075) | - | 366835..367806 (+) | 972 | WP_011888780.1 | Abi family protein | - |
| ACB354_RS02080 (ACB354_02080) | - | 367991..368191 (+) | 201 | WP_003058228.1 | CsbD family protein | - |
| ACB354_RS02085 (ACB354_02085) | - | 368253..369053 (-) | 801 | WP_021340119.1 | DNA/RNA non-specific endonuclease | - |
| ACB354_RS02090 (ACB354_02090) | prx | 369291..369473 (+) | 183 | WP_011184907.1 | hypothetical protein | Regulator |
| ACB354_RS02095 (ACB354_02095) | uvrA | 369687..372515 (+) | 2829 | WP_023077881.1 | excinuclease ABC subunit UvrA | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6976.99 Da Isoelectric Point: 4.2550
>NTDB_id=1037029 ACB354_RS02090 WP_011184907.1 369291..369473(+) (prx) [Streptococcus pyogenes strain Isolate 28]
MLTYDEFKQAIDRGYITGDTVMIVRKNGQIFDYVLPHEKVKNGEVVTEEIVEEVMVELDK
MLTYDEFKQAIDRGYITGDTVMIVRKNGQIFDYVLPHEKVKNGEVVTEEIVEEVMVELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=1037029 ACB354_RS02090 WP_011184907.1 369291..369473(+) (prx) [Streptococcus pyogenes strain Isolate 28]
ATGCTAACATACGACGAGTTTAAACAAGCGATTGACCGTGGATATATCACAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTTTTGCCACATGAGAAAGTAAAAAATGGAGAAGTTGTGACCGAGGAGATAGTGGAAGAAG
TGATGGTGGAATTAGACAAATAA
ATGCTAACATACGACGAGTTTAAACAAGCGATTGACCGTGGATATATCACAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTTTTGCCACATGAGAAAGTAAAAAATGGAGAAGTTGTGACCGAGGAGATAGTGGAAGAAG
TGATGGTGGAATTAGACAAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS8232 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
83.333 |
100 |
0.833 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
88.372 |
71.667 |
0.633 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |