Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | AB3422_RS13460 | Genome accession | NZ_CP162463 |
| Coordinates | 2679277..2679747 (-) | Length | 156 a.a. |
| NCBI ID | WP_000934753.1 | Uniprot ID | A0A1S5YP95 |
| Organism | Staphylococcus aureus strain TUM20888 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2649577..2697451 | 2679277..2679747 | within | 0 |
Gene organization within MGE regions
Location: 2649577..2697451
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AB3422_RS13240 (AB3422_13240) | scn | 2649577..2649927 (-) | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| AB3422_RS13245 (AB3422_13245) | - | 2650612..2651061 (+) | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
| AB3422_RS13250 (AB3422_13250) | - | 2651156..2651491 (-) | 336 | Protein_2578 | SH3 domain-containing protein | - |
| AB3422_RS13255 (AB3422_13255) | sak | 2652141..2652632 (-) | 492 | WP_000919350.1 | staphylokinase | - |
| AB3422_RS13260 (AB3422_13260) | - | 2652823..2653578 (-) | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| AB3422_RS13265 (AB3422_13265) | - | 2653590..2653844 (-) | 255 | WP_000611512.1 | phage holin | - |
| AB3422_RS13270 (AB3422_13270) | - | 2653896..2654003 (+) | 108 | WP_001791821.1 | hypothetical protein | - |
| AB3422_RS13275 (AB3422_13275) | pepG1 | 2654056..2654190 (-) | 135 | WP_000226108.1 | type I toxin-antitoxin system toxin PepG1 | - |
| AB3422_RS13280 (AB3422_13280) | - | 2654382..2654678 (-) | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| AB3422_RS13285 (AB3422_13285) | - | 2654736..2655023 (-) | 288 | WP_001040261.1 | hypothetical protein | - |
| AB3422_RS13290 (AB3422_13290) | - | 2655070..2655222 (-) | 153 | WP_001153681.1 | hypothetical protein | - |
| AB3422_RS13295 (AB3422_13295) | - | 2655212..2658997 (-) | 3786 | WP_000582165.1 | phage tail spike protein | - |
| AB3422_RS13300 (AB3422_13300) | - | 2659013..2660497 (-) | 1485 | WP_000567394.1 | phage tail domain-containing protein | - |
| AB3422_RS13305 (AB3422_13305) | - | 2660494..2665023 (-) | 4530 | WP_001551779.1 | phage tail tape measure protein | - |
| AB3422_RS13310 (AB3422_13310) | - | 2665080..2665214 (-) | 135 | WP_000364140.1 | hypothetical protein | - |
| AB3422_RS13315 (AB3422_13315) | - | 2665268..2665618 (-) | 351 | WP_001096354.1 | phage tail assembly chaperone G | - |
| AB3422_RS13320 (AB3422_13320) | - | 2665668..2665907 (-) | 240 | WP_094969769.1 | Ig-like domain-containing protein | - |
| AB3422_RS13325 (AB3422_13325) | - | 2665934..2666578 (-) | 645 | WP_000260578.1 | major tail protein | - |
| AB3422_RS13330 (AB3422_13330) | - | 2666582..2666986 (-) | 405 | WP_000565500.1 | hypothetical protein | - |
| AB3422_RS13335 (AB3422_13335) | - | 2666983..2667387 (-) | 405 | WP_000114229.1 | HK97 gp10 family phage protein | - |
| AB3422_RS13340 (AB3422_13340) | - | 2667384..2667746 (-) | 363 | WP_000755150.1 | head-tail adaptor protein | - |
| AB3422_RS13345 (AB3422_13345) | - | 2667730..2668014 (-) | 285 | WP_000150936.1 | phage head-tail adapter protein | - |
| AB3422_RS13350 (AB3422_13350) | - | 2668004..2668288 (-) | 285 | WP_000238236.1 | hypothetical protein | - |
| AB3422_RS13355 (AB3422_13355) | - | 2668308..2669453 (-) | 1146 | WP_000154559.1 | phage major capsid protein | - |
| AB3422_RS13360 (AB3422_13360) | - | 2669477..2670214 (-) | 738 | WP_000642728.1 | head maturation protease, ClpP-related | - |
| AB3422_RS13365 (AB3422_13365) | - | 2670198..2671385 (-) | 1188 | WP_000025274.1 | phage portal protein | - |
| AB3422_RS13370 (AB3422_13370) | - | 2671401..2673062 (-) | 1662 | WP_368409943.1 | terminase TerL endonuclease subunit | - |
| AB3422_RS13375 (AB3422_13375) | - | 2673059..2673403 (-) | 345 | WP_000402904.1 | hypothetical protein | - |
| AB3422_RS13380 (AB3422_13380) | - | 2673533..2673832 (-) | 300 | WP_000988336.1 | HNH endonuclease | - |
| AB3422_RS13385 (AB3422_13385) | - | 2674064..2674480 (-) | 417 | WP_000590122.1 | hypothetical protein | - |
| AB3422_RS13390 (AB3422_13390) | - | 2674508..2674708 (-) | 201 | WP_000265043.1 | DUF1514 family protein | - |
| AB3422_RS13395 (AB3422_13395) | - | 2674708..2674857 (-) | 150 | WP_000595265.1 | transcriptional activator RinB | - |
| AB3422_RS13400 (AB3422_13400) | - | 2674854..2675240 (-) | 387 | WP_000592207.1 | hypothetical protein | - |
| AB3422_RS13405 (AB3422_13405) | - | 2675237..2675443 (-) | 207 | WP_000195803.1 | DUF1381 domain-containing protein | - |
| AB3422_RS13410 (AB3422_13410) | - | 2675440..2675685 (-) | 246 | WP_001282074.1 | hypothetical protein | - |
| AB3422_RS13415 (AB3422_13415) | - | 2675722..2676255 (-) | 534 | WP_000181819.1 | dUTP diphosphatase | - |
| AB3422_RS13420 (AB3422_13420) | - | 2676248..2676490 (-) | 243 | WP_000700108.1 | hypothetical protein | - |
| AB3422_RS13425 (AB3422_13425) | - | 2676480..2676716 (-) | 237 | WP_001065101.1 | DUF1024 family protein | - |
| AB3422_RS13430 (AB3422_13430) | - | 2676709..2677080 (-) | 372 | WP_001549172.1 | hypothetical protein | - |
| AB3422_RS13435 (AB3422_13435) | - | 2677089..2677331 (-) | 243 | WP_000131383.1 | phi PVL orf 51-like protein | - |
| AB3422_RS13440 (AB3422_13440) | - | 2677335..2677703 (-) | 369 | WP_000101288.1 | SA1788 family PVL leukocidin-associated protein | - |
| AB3422_RS13445 (AB3422_13445) | - | 2677716..2678120 (-) | 405 | WP_000401977.1 | RusA family crossover junction endodeoxyribonuclease | - |
| AB3422_RS13450 (AB3422_13450) | - | 2678129..2678347 (-) | 219 | WP_000338530.1 | hypothetical protein | - |
| AB3422_RS13455 (AB3422_13455) | - | 2678354..2679247 (-) | 894 | WP_000148333.1 | DnaD domain-containing protein | - |
| AB3422_RS13460 (AB3422_13460) | ssbA | 2679277..2679747 (-) | 471 | WP_000934753.1 | single-stranded DNA-binding protein | Machinery gene |
| AB3422_RS13465 (AB3422_13465) | - | 2679748..2680365 (-) | 618 | WP_071665632.1 | MBL fold metallo-hydrolase | - |
| AB3422_RS13470 (AB3422_13470) | - | 2680446..2681366 (-) | 921 | WP_000138475.1 | recombinase RecT | - |
| AB3422_RS13475 (AB3422_13475) | - | 2681368..2683311 (-) | 1944 | WP_000700561.1 | AAA family ATPase | - |
| AB3422_RS13480 (AB3422_13480) | - | 2683320..2683583 (-) | 264 | WP_001205732.1 | hypothetical protein | - |
| AB3422_RS13485 (AB3422_13485) | - | 2683592..2683852 (-) | 261 | WP_000291513.1 | DUF1108 family protein | - |
| AB3422_RS13490 (AB3422_13490) | - | 2683833..2684152 (-) | 320 | Protein_2626 | DUF2482 family protein | - |
| AB3422_RS13495 (AB3422_13495) | - | 2684247..2684408 (-) | 162 | WP_001285960.1 | DUF1270 domain-containing protein | - |
| AB3422_RS13500 (AB3422_13500) | - | 2684405..2684725 (-) | 321 | WP_001120199.1 | DUF771 domain-containing protein | - |
| AB3422_RS13505 (AB3422_13505) | - | 2684784..2685014 (+) | 231 | WP_000549548.1 | hypothetical protein | - |
| AB3422_RS13510 (AB3422_13510) | - | 2685011..2685187 (-) | 177 | WP_001001356.1 | hypothetical protein | - |
| AB3422_RS13515 (AB3422_13515) | - | 2685203..2685955 (-) | 753 | WP_001148642.1 | phage antirepressor KilAC domain-containing protein | - |
| AB3422_RS13520 (AB3422_13520) | - | 2686006..2686335 (+) | 330 | WP_000180411.1 | hypothetical protein | - |
| AB3422_RS13525 (AB3422_13525) | - | 2686324..2686539 (-) | 216 | WP_001025404.1 | MW1434 family type I TA system toxin | - |
| AB3422_RS13530 (AB3422_13530) | - | 2686555..2686818 (-) | 264 | WP_000854072.1 | helix-turn-helix transcriptional regulator | - |
| AB3422_RS13535 (AB3422_13535) | - | 2686815..2686988 (-) | 174 | WP_001801500.1 | hypothetical protein | - |
| AB3422_RS13540 (AB3422_13540) | - | 2686951..2687664 (+) | 714 | WP_001031454.1 | XRE family transcriptional regulator | - |
| AB3422_RS13545 (AB3422_13545) | - | 2687680..2688612 (+) | 933 | WP_000759682.1 | exonuclease domain-containing protein | - |
| AB3422_RS13550 (AB3422_13550) | - | 2688618..2688959 (+) | 342 | WP_000591749.1 | hypothetical protein | - |
| AB3422_RS13555 (AB3422_13555) | - | 2689163..2689345 (+) | 183 | WP_000705246.1 | hypothetical protein | - |
| AB3422_RS13560 (AB3422_13560) | - | 2689423..2690136 (+) | 714 | WP_001549185.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| AB3422_RS13565 (AB3422_13565) | - | 2690327..2691364 (+) | 1038 | WP_000857199.1 | site-specific integrase | - |
| AB3422_RS13570 (AB3422_13570) | sph | 2691415..2692245 (+) | 831 | Protein_2642 | sphingomyelin phosphodiesterase | - |
| AB3422_RS13575 (AB3422_13575) | lukG | 2692483..2693499 (-) | 1017 | WP_000595324.1 | bi-component leukocidin LukGH subunit G | - |
| AB3422_RS13580 (AB3422_13580) | lukH | 2693521..2694576 (-) | 1056 | WP_000791407.1 | bi-component leukocidin LukGH subunit H | - |
| AB3422_RS13585 (AB3422_13585) | - | 2695011..2696234 (+) | 1224 | WP_000206639.1 | ArgE/DapE family deacylase | - |
| AB3422_RS13590 (AB3422_13590) | - | 2696606..2697451 (-) | 846 | WP_000812010.1 | class I SAM-dependent methyltransferase | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17668.55 Da Isoelectric Point: 5.2672
>NTDB_id=1026098 AB3422_RS13460 WP_000934753.1 2679277..2679747(-) (ssbA) [Staphylococcus aureus strain TUM20888]
MLNRTILVGRLTRDPELRTTQNGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
MLNRTILVGRLTRDPELRTTQNGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=1026098 AB3422_RS13460 WP_000934753.1 2679277..2679747(-) (ssbA) [Staphylococcus aureus strain TUM20888]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAATGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACAAATGCACAAGGCGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTAA
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAATGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACAAATGCACAAGGCGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
56.497 |
100 |
0.641 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50 |
100 |
0.545 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
33.333 |
100 |
0.378 |
| ssb | Neisseria meningitidis MC58 |
33.526 |
100 |
0.372 |
| ssb | Neisseria gonorrhoeae MS11 |
33.526 |
100 |
0.372 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
47.5 |
76.923 |
0.365 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
47.5 |
76.923 |
0.365 |