Detailed information NTG1020635

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: ABVF41_RS09195
• Genome accession: NZ_CP160385
• Coordinates: 1854155..1854469 (-)
• Length: 104 a.a.
• NCBI ID: WP_002263437.1
• Uniprot ID: -
• Organism: Streptococcus mutans strain UA159-WCSS
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1849155..1859469

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
ABVF41_RS09155 (ABVF41_09155)	-	1849222..1849662 (-)	441	WP_002263445.1	hypothetical protein	-
ABVF41_RS09160 (ABVF41_09160)	-	1849631..1849876 (-)	246	WP_002263444.1	helix-turn-helix transcriptional regulator	-
ABVF41_RS09165 (ABVF41_09165)	-	1850445..1851644 (-)	1200	WP_002263443.1	acetate kinase	-
ABVF41_RS09170 (ABVF41_09170)	comYH	1851703..1852656 (-)	954	WP_002263442.1	class I SAM-dependent methyltransferase	Machinery gene
ABVF41_RS09175 (ABVF41_09175)	comYG	1852711..1853100 (-)	390	WP_002263441.1	competence type IV pilus minor pilin ComGG	Machinery gene
ABVF41_RS09180 (ABVF41_09180)	comYF	1853078..1853512 (-)	435	WP_002263440.1	competence type IV pilus minor pilin ComGF	Machinery gene
ABVF41_RS09185 (ABVF41_09185)	comYE	1853499..1853792 (-)	294	WP_002263439.1	competence type IV pilus minor pilin ComGE	Machinery gene
ABVF41_RS09190 (ABVF41_09190)	comYD	1853764..1854168 (-)	405	WP_002263438.1	competence type IV pilus minor pilin ComGD	Machinery gene
ABVF41_RS09195 (ABVF41_09195)	comYC	1854155..1854469 (-)	315	WP_002263437.1	competence type IV pilus major pilin ComGC	Machinery gene
ABVF41_RS09200 (ABVF41_09200)	comYB	1854469..1855500 (-)	1032	WP_255262721.1	competence type IV pilus assembly protein ComGB	Machinery gene
ABVF41_RS09205 (ABVF41_09205)	comYA	1855436..1856377 (-)	942	WP_002263435.1	competence type IV pilus ATPase ComGA	Machinery gene
ABVF41_RS09210 (ABVF41_09210)	-	1856507..1856890 (-)	384	WP_002263434.1	DUF1033 family protein	-

Sequence

Protein

• Length: 104 a.a.
• Molecular weight: 11591.60 Da
• Isoelectric Point: 10.2206

>NTDB_id=1020635 ABVF41_RS09195 WP_002263437.1 1854155..1854469(-) (comYC) [Streptococcus mutans strain UA159-WCSS]
MKKIKRVSVRAFTLIEMLVVLLIISILLLLFVPNLTKQKDKVKDTGGSAVVKVVESQAELYELNKTDSATLSKLVASGDI
TQEQANSYKDYYAKHPSKTRHVAN

Nucleotide

• Length: 315 bp

>NTDB_id=1020635 ABVF41_RS09195 WP_002263437.1 1854155..1854469(-) (comYC) [Streptococcus mutans strain UA159-WCSS]
ATGAAAAAGATCAAGAGAGTCAGTGTACGGGCTTTTACGCTTATAGAAATGTTAGTAGTTCTTCTCATTATTAGTATTCT
TTTACTATTATTTGTTCCTAATTTAACTAAGCAAAAAGATAAGGTAAAAGATACTGGCGGTTCTGCCGTGGTTAAAGTTG
TAGAAAGTCAGGCTGAGCTTTATGAGCTTAATAAAACCGATTCTGCTACTCTTTCTAAATTAGTAGCTAGTGGTGATATT
ACACAAGAACAGGCAAATTCATACAAGGATTACTATGCAAAACACCCAAGTAAAACACGGCATGTCGCGAATTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (9-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus mutans UA140	100	100	1
comYC	Streptococcus mutans UA159	100	100	1
comYC	Streptococcus gordonii str. Challis substr. CH1	71.429	100	0.721
comGC/cglC	Streptococcus mitis SK321	66.667	95.192	0.635
comGC/cglC	Streptococcus mitis NCTC 12261	69.565	88.462	0.615
comGC/cglC	Streptococcus pneumoniae R6	63.636	95.192	0.606
comGC/cglC	Streptococcus pneumoniae Rx1	63.636	95.192	0.606
comGC/cglC	Streptococcus pneumoniae D39	63.636	95.192	0.606
comGC/cglC	Streptococcus pneumoniae TIGR4	63.636	95.192	0.606
comGC	Lactococcus lactis subsp. cremoris KW2	55.446	97.115	0.538
comYC	Streptococcus suis isolate S10	60.227	84.615	0.51