Detailed information
Bioinformatically predicted
Overview
| Name | comC/comC2 | Type | Regulator |
| Locus tag | ABKJ27_RS00065 | Genome accession | NZ_CP157578 |
| Coordinates | 5883..6005 (+) | Length | 40 a.a. |
| NCBI ID | WP_045612506.1 | Uniprot ID | Q9X989 |
| Organism | Streptococcus sp. KHUD_011 | ||
| Function | binding to ComD; induce autophosphorylation of ComD (predicted from homology) Competence regulation |
||
Genomic Context
Location: 883..11005
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ABKJ27_RS00040 (ABKJ27_00045) | dnaA | 1365..2726 (-) | 1362 | WP_084950575.1 | chromosomal replication initiator protein DnaA | - |
| ABKJ27_RS00045 (ABKJ27_00050) | spo0J | 2939..3697 (-) | 759 | WP_410011773.1 | ParB/RepB/Spo0J family partition protein | Regulator |
| ABKJ27_RS00050 (ABKJ27_00055) | htrA | 3755..4936 (-) | 1182 | WP_410011774.1 | S1C family serine protease | Regulator |
| ABKJ27_RS00055 (ABKJ27_00060) | rlmH | 5120..5599 (+) | 480 | WP_410011775.1 | 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH | - |
| ABKJ27_RS00065 (ABKJ27_00070) | comC/comC2 | 5883..6005 (+) | 123 | WP_045612506.1 | competence-stimulating peptide ComC | Regulator |
| ABKJ27_RS00070 (ABKJ27_00075) | comD/comD1 | 6018..7343 (+) | 1326 | WP_410011776.1 | competence system sensor histidine kinase ComD | Regulator |
| ABKJ27_RS00075 (ABKJ27_00080) | comE | 7340..8092 (+) | 753 | WP_410011777.1 | competence system response regulator transcription factor ComE | Regulator |
| ABKJ27_RS00090 (ABKJ27_00095) | - | 8334..8876 (-) | 543 | WP_001158275.1 | TetR/AcrR family transcriptional regulator | - |
Sequence
Protein
Download Length: 40 a.a. Molecular weight: 4734.60 Da Isoelectric Point: 11.0565
>NTDB_id=1007423 ABKJ27_RS00065 WP_045612506.1 5883..6005(+) (comC/comC2) [Streptococcus sp. KHUD_011]
MKNTVKLEQFVALKEKDLQKIQGGEMRKPDGALFNLFRRR
MKNTVKLEQFVALKEKDLQKIQGGEMRKPDGALFNLFRRR
Nucleotide
Download Length: 123 bp
>NTDB_id=1007423 ABKJ27_RS00065 WP_045612506.1 5883..6005(+) (comC/comC2) [Streptococcus sp. KHUD_011]
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCCTTGAAGGAAAAAGACTTGCAAAAGATTCAAGGTGGGGAGATGAG
GAAACCAGATGGTGCTTTATTTAATTTATTTAGAAGAAGATAA
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCCTTGAAGGAAAAAGACTTGCAAAAGATTCAAGGTGGGGAGATGAG
GAAACCAGATGGTGCTTTATTTAATTTATTTAGAAGAAGATAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comC/comC2 | Streptococcus pneumoniae A66 |
75 |
100 |
0.75 |
| comC/comC2 | Streptococcus pneumoniae TIGR4 |
75 |
100 |
0.75 |
| comC | Streptococcus mitis NCTC 12261 |
65 |
100 |
0.65 |
| comC | Streptococcus mitis SK321 |
89.655 |
72.5 |
0.65 |
| comC/comC1 | Streptococcus pneumoniae G54 |
96.296 |
67.5 |
0.65 |
| comC/comC1 | Streptococcus pneumoniae D39 |
96.296 |
67.5 |
0.65 |
| comC/comC1 | Streptococcus pneumoniae Rx1 |
96.296 |
67.5 |
0.65 |
| comC/comC1 | Streptococcus pneumoniae R6 |
96.296 |
67.5 |
0.65 |