Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | UXR68_RS09635 | Genome accession | NZ_CP157301 |
| Coordinates | 1972159..1972629 (-) | Length | 156 a.a. |
| NCBI ID | WP_000934764.1 | Uniprot ID | A0A9P4DKA4 |
| Organism | Staphylococcus aureus strain BSN84 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1943975..1994945 | 1972159..1972629 | within | 0 |
Gene organization within MGE regions
Location: 1943975..1994945
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| UXR68_RS09430 (UXR68_09430) | scn | 1943975..1944325 (-) | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| UXR68_RS09435 (UXR68_09435) | - | 1945010..1945459 (+) | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
| UXR68_RS09440 (UXR68_09440) | - | 1945554..1947008 (-) | 1455 | WP_000930259.1 | N-acetylmuramoyl-L-alanine amidase | - |
| UXR68_RS09445 (UXR68_09445) | - | 1947020..1947322 (-) | 303 | WP_000387656.1 | phage holin | - |
| UXR68_RS09450 (UXR68_09450) | - | 1947373..1947477 (+) | 105 | Protein_1826 | hypothetical protein | - |
| UXR68_RS09455 (UXR68_09455) | - | 1947521..1947628 (-) | 108 | WP_000253688.1 | putative holin-like toxin | - |
| UXR68_RS09460 (UXR68_09460) | - | 1947860..1948156 (-) | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| UXR68_RS09465 (UXR68_09465) | - | 1948214..1948501 (-) | 288 | WP_001040257.1 | hypothetical protein | - |
| UXR68_RS09470 (UXR68_09470) | - | 1948548..1948700 (-) | 153 | WP_001181555.1 | hypothetical protein | - |
| UXR68_RS09475 (UXR68_09475) | - | 1948687..1952367 (-) | 3681 | WP_000582140.1 | phage tail spike protein | - |
| UXR68_RS09480 (UXR68_09480) | - | 1952383..1953867 (-) | 1485 | WP_000567415.1 | phage tail domain-containing protein | - |
| UXR68_RS09485 (UXR68_09485) | - | 1953864..1958393 (-) | 4530 | WP_001807909.1 | phage tail tape measure protein | - |
| UXR68_RS09490 (UXR68_09490) | gpGT | 1958450..1958587 (-) | 138 | WP_001549167.1 | phage tail assembly chaperone GT | - |
| UXR68_RS09495 (UXR68_09495) | gpG | 1958638..1958988 (-) | 351 | WP_001096355.1 | phage tail assembly chaperone G | - |
| UXR68_RS09500 (UXR68_09500) | - | 1959038..1959262 (-) | 225 | WP_072050172.1 | Ig-like domain-containing protein | - |
| UXR68_RS09505 (UXR68_09505) | - | 1959304..1959948 (-) | 645 | WP_000268741.1 | major tail protein | - |
| UXR68_RS09510 (UXR68_09510) | - | 1959949..1960356 (-) | 408 | WP_000565496.1 | hypothetical protein | - |
| UXR68_RS09515 (UXR68_09515) | - | 1960353..1960757 (-) | 405 | WP_000114226.1 | HK97 gp10 family phage protein | - |
| UXR68_RS09520 (UXR68_09520) | - | 1960754..1961116 (-) | 363 | WP_000755150.1 | head-tail adaptor protein | - |
| UXR68_RS09525 (UXR68_09525) | - | 1961100..1961384 (-) | 285 | WP_000150936.1 | phage head-tail adapter protein | - |
| UXR68_RS09530 (UXR68_09530) | - | 1961374..1961658 (-) | 285 | WP_000238236.1 | hypothetical protein | - |
| UXR68_RS09535 (UXR68_09535) | - | 1961678..1962823 (-) | 1146 | WP_000154559.1 | phage major capsid protein | - |
| UXR68_RS09540 (UXR68_09540) | - | 1962847..1963584 (-) | 738 | WP_000642728.1 | head maturation protease, ClpP-related | - |
| UXR68_RS09545 (UXR68_09545) | - | 1963568..1964755 (-) | 1188 | WP_000025274.1 | phage portal protein | - |
| UXR68_RS09550 (UXR68_09550) | - | 1964771..1966432 (-) | 1662 | WP_000625088.1 | terminase large subunit | - |
| UXR68_RS09555 (UXR68_09555) | - | 1966429..1966773 (-) | 345 | WP_000402904.1 | hypothetical protein | - |
| UXR68_RS09560 (UXR68_09560) | - | 1966903..1967202 (-) | 300 | WP_000988336.1 | HNH endonuclease | - |
| UXR68_RS09565 (UXR68_09565) | - | 1967434..1967850 (-) | 417 | WP_000590122.1 | hypothetical protein | - |
| UXR68_RS09570 (UXR68_09570) | - | 1967878..1968078 (-) | 201 | WP_000265043.1 | DUF1514 family protein | - |
| UXR68_RS09575 (UXR68_09575) | rinB | 1968078..1968227 (-) | 150 | WP_000595265.1 | transcriptional activator RinB | - |
| UXR68_RS09580 (UXR68_09580) | - | 1968224..1968610 (-) | 387 | WP_000592207.1 | hypothetical protein | - |
| UXR68_RS09585 (UXR68_09585) | - | 1968607..1968813 (-) | 207 | WP_000195803.1 | DUF1381 domain-containing protein | - |
| UXR68_RS09590 (UXR68_09590) | - | 1968850..1969392 (-) | 543 | WP_000185660.1 | dUTP diphosphatase | - |
| UXR68_RS09595 (UXR68_09595) | - | 1969385..1969567 (-) | 183 | WP_000028422.1 | hypothetical protein | - |
| UXR68_RS09600 (UXR68_09600) | - | 1969557..1969808 (-) | 252 | WP_001065091.1 | DUF1024 family protein | - |
| UXR68_RS09605 (UXR68_09605) | - | 1969801..1969968 (-) | 168 | WP_001624242.1 | hypothetical protein | - |
| UXR68_RS09610 (UXR68_09610) | - | 1969980..1970222 (-) | 243 | WP_000131366.1 | SAV1978 family virulence-associated passenger protein | - |
| UXR68_RS09615 (UXR68_09615) | - | 1970226..1970594 (-) | 369 | WP_000101274.1 | SA1788 family PVL leukocidin-associated protein | - |
| UXR68_RS09620 (UXR68_09620) | - | 1970607..1971011 (-) | 405 | WP_000401960.1 | RusA family crossover junction endodeoxyribonuclease | - |
| UXR68_RS09625 (UXR68_09625) | - | 1971020..1971238 (-) | 219 | WP_000338530.1 | hypothetical protein | - |
| UXR68_RS09630 (UXR68_09630) | - | 1971245..1972129 (-) | 885 | WP_000148316.1 | DnaD domain protein | - |
| UXR68_RS09635 (UXR68_09635) | ssbA | 1972159..1972629 (-) | 471 | WP_000934764.1 | single-stranded DNA-binding protein | Machinery gene |
| UXR68_RS09640 (UXR68_09640) | - | 1972630..1973247 (-) | 618 | WP_071621397.1 | MBL fold metallo-hydrolase | - |
| UXR68_RS09645 (UXR68_09645) | - | 1973328..1974248 (-) | 921 | WP_000138472.1 | recombinase RecT | - |
| UXR68_RS09650 (UXR68_09650) | - | 1974250..1976193 (-) | 1944 | WP_000700577.1 | AAA family ATPase | - |
| UXR68_RS09655 (UXR68_09655) | - | 1976202..1976465 (-) | 264 | WP_001205732.1 | hypothetical protein | - |
| UXR68_RS09660 (UXR68_09660) | - | 1976474..1976734 (-) | 261 | WP_000291503.1 | DUF1108 family protein | - |
| UXR68_RS09665 (UXR68_09665) | - | 1976715..1977041 (-) | 327 | WP_336233767.1 | DUF2482 family protein | - |
| UXR68_RS09670 (UXR68_09670) | - | 1977136..1977297 (-) | 162 | WP_000066017.1 | DUF1270 domain-containing protein | - |
| UXR68_RS09675 (UXR68_09675) | - | 1977294..1977614 (-) | 321 | WP_001120197.1 | DUF771 domain-containing protein | - |
| UXR68_RS09680 (UXR68_09680) | - | 1977673..1978305 (+) | 633 | WP_000275058.1 | hypothetical protein | - |
| UXR68_RS09685 (UXR68_09685) | - | 1978320..1978460 (-) | 141 | WP_000939496.1 | hypothetical protein | - |
| UXR68_RS09690 (UXR68_09690) | - | 1978491..1978688 (-) | 198 | WP_001148855.1 | hypothetical protein | - |
| UXR68_RS09695 (UXR68_09695) | - | 1978704..1979456 (-) | 753 | WP_001148605.1 | phage antirepressor KilAC domain-containing protein | - |
| UXR68_RS09700 (UXR68_09700) | - | 1979507..1979836 (+) | 330 | WP_000128907.1 | hypothetical protein | - |
| UXR68_RS09705 (UXR68_09705) | - | 1979825..1980040 (-) | 216 | WP_001025874.1 | MW1434 family type I TA system toxin | - |
| UXR68_RS09710 (UXR68_09710) | - | 1980056..1980319 (-) | 264 | WP_000854072.1 | helix-turn-helix transcriptional regulator | - |
| UXR68_RS09715 (UXR68_09715) | - | 1980316..1980489 (-) | 174 | WP_001801500.1 | hypothetical protein | - |
| UXR68_RS09720 (UXR68_09720) | - | 1980452..1981165 (+) | 714 | WP_001031454.1 | XRE family transcriptional regulator | - |
| UXR68_RS09725 (UXR68_09725) | - | 1981181..1982113 (+) | 933 | WP_000759682.1 | exonuclease domain-containing protein | - |
| UXR68_RS09730 (UXR68_09730) | - | 1982119..1982460 (+) | 342 | WP_000591749.1 | hypothetical protein | - |
| UXR68_RS09735 (UXR68_09735) | - | 1982664..1982846 (+) | 183 | WP_000705248.1 | hypothetical protein | - |
| UXR68_RS09740 (UXR68_09740) | - | 1982946..1983410 (+) | 465 | WP_000825947.1 | hypothetical protein | - |
| UXR68_RS09745 (UXR68_09745) | - | 1983469..1984506 (+) | 1038 | WP_000857185.1 | site-specific integrase | - |
| UXR68_RS09750 (UXR68_09750) | sph | 1984563..1985336 (+) | 774 | Protein_1886 | sphingomyelin phosphodiesterase | - |
| UXR68_RS09755 (UXR68_09755) | - | 1985649..1986665 (-) | 1017 | WP_000595612.1 | leukocidin/hemolysin toxin family protein | - |
| UXR68_RS09760 (UXR68_09760) | - | 1986687..1987742 (-) | 1056 | WP_000791397.1 | leukocidin family pore-forming toxin | - |
| UXR68_RS09765 (UXR68_09765) | - | 1988174..1989397 (+) | 1224 | WP_000206618.1 | ArgE/DapE family deacylase | - |
| UXR68_RS09770 (UXR68_09770) | - | 1989780..1991087 (+) | 1308 | WP_001045074.1 | TrkH family potassium uptake protein | - |
| UXR68_RS09775 (UXR68_09775) | - | 1991626..1992252 (-) | 627 | WP_000216896.1 | hypothetical protein | - |
| UXR68_RS09780 (UXR68_09780) | - | 1992249..1992428 (-) | 180 | WP_000201398.1 | hypothetical protein | - |
| UXR68_RS09785 (UXR68_09785) | groL | 1992969..1994585 (-) | 1617 | WP_000240642.1 | chaperonin GroEL | - |
| UXR68_RS09790 (UXR68_09790) | groES | 1994661..1994945 (-) | 285 | WP_000917289.1 | co-chaperone GroES | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17627.49 Da Isoelectric Point: 5.2672
>NTDB_id=1005565 UXR68_RS09635 WP_000934764.1 1972159..1972629(-) (ssbA) [Staphylococcus aureus strain BSN84]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVVADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVVADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=1005565 UXR68_RS09635 WP_000934764.1 1972159..1972629(-) (ssbA) [Staphylococcus aureus strain BSN84]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTGTTGCCGATAGTATTCAATTTTTAGAACCGAAGAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTGA
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTGTTGCCGATAGTATTCAATTTTTAGAACCGAAGAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.932 |
100 |
0.635 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
51.176 |
100 |
0.558 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Neisseria meningitidis MC58 |
33.526 |
100 |
0.372 |
| ssb | Neisseria gonorrhoeae MS11 |
33.526 |
100 |
0.372 |
| ssb | Glaesserella parasuis strain SC1401 |
32.768 |
100 |
0.372 |
| ssb | Vibrio cholerae strain A1552 |
31.492 |
100 |
0.365 |