Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/RelE-RelB |
Location | 1928666..1929225 | Replicon | chromosome |
Accession | NC_004603 | ||
Organism | Vibrio parahaemolyticus RIMD 2210633 |
Toxin (Protein)
Gene name | relE | Uniprot ID | Q87NN8 |
Locus tag | VP_RS08855 | Protein ID | WP_005483280.1 |
Coordinates | 1928947..1929225 (+) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | Q87NN9 |
Locus tag | VP_RS08850 | Protein ID | WP_005483268.1 |
Coordinates | 1928666..1928950 (+) | Length | 95 a.a. |
Genomic Context
Location: 1928666..1928950 (285 bp)
Type: Antitoxin
Protein ID: WP_005483268.1
Type: Antitoxin
Protein ID: WP_005483268.1
Location: 1928947..1929225 (279 bp)
Type: Toxin
Protein ID: WP_005483280.1
Type: Toxin
Protein ID: WP_005483280.1
Location: 1923710..1924879 (1170 bp)
Type: Others
Protein ID: WP_005483289.1
Type: Others
Protein ID: WP_005483289.1
Location: 1924843..1924935 (93 bp)
Type: Others
Protein ID: WP_072833197.1
Type: Others
Protein ID: WP_072833197.1
Location: 1924950..1925483 (534 bp)
Type: Others
Protein ID: WP_005483198.1
Type: Others
Protein ID: WP_005483198.1
Location: 1925581..1925673 (93 bp)
Type: Others
Protein ID: WP_005464677.1
Type: Others
Protein ID: WP_005464677.1
Location: 1925696..1926466 (771 bp)
Type: Others
Protein ID: WP_005464405.1
Type: Others
Protein ID: WP_005464405.1
Location: 1926537..1927358 (822 bp)
Type: Others
Protein ID: WP_005464673.1
Type: Others
Protein ID: WP_005464673.1
Location: 1927333..1927473 (141 bp)
Type: Others
Protein ID: WP_162828790.1
Type: Others
Protein ID: WP_162828790.1
Location: 1927502..1928044 (543 bp)
Type: Others
Protein ID: WP_005464345.1
Type: Others
Protein ID: WP_005464345.1
Location: 1928077..1928166 (90 bp)
Type: Others
Protein ID: WP_072833190.1
Type: Others
Protein ID: WP_072833190.1
Location: 1928198..1928470 (273 bp)
Type: Others
Protein ID: WP_005462157.1
Type: Others
Protein ID: WP_005462157.1
Location: 1928497..1928664 (168 bp)
Type: Others
Protein ID: WP_078532952.1
Type: Others
Protein ID: WP_078532952.1
Location: 1929254..1929364 (111 bp)
Type: Others
Protein ID: WP_082798391.1
Type: Others
Protein ID: WP_082798391.1
Location: 1929372..1929656 (285 bp)
Type: Others
Protein ID: WP_005483310.1
Type: Others
Protein ID: WP_005483310.1
Location: 1929701..1929823 (123 bp)
Type: Others
Protein ID: WP_078511351.1
Type: Others
Protein ID: WP_078511351.1
Location: 1929820..1930296 (477 bp)
Type: Others
Protein ID: WP_005483302.1
Type: Others
Protein ID: WP_005483302.1
Location: 1930324..1930425 (102 bp)
Type: Others
Protein ID: WP_011105959.1
Type: Others
Protein ID: WP_011105959.1
Location: 1930441..1930726 (286 bp)
Type: Others
Protein ID: Protein_1729
Type: Others
Protein ID: Protein_1729
Location: 1930888..1931355 (468 bp)
Type: Others
Protein ID: WP_005464650.1
Type: Others
Protein ID: WP_005464650.1
Location: 1931456..1931533 (78 bp)
Type: Others
Protein ID: WP_072833152.1
Type: Others
Protein ID: WP_072833152.1
Location: 1931562..1931936 (375 bp)
Type: Others
Protein ID: WP_005483170.1
Type: Others
Protein ID: WP_005483170.1
Location: 1932074..1932583 (510 bp)
Type: Others
Protein ID: WP_005483274.1
Type: Others
Protein ID: WP_005483274.1
Location: 1933192..1933284 (93 bp)
Type: Others
Protein ID: WP_011105963.1
Type: Others
Protein ID: WP_011105963.1
Location: 1933312..1933824 (513 bp)
Type: Others
Protein ID: WP_024699234.1
Type: Others
Protein ID: WP_024699234.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
VP_RS08795 (VP1823) | 1923710..1924879 | - | 1170 | WP_005483289.1 | hypothetical protein | - |
VP_RS08800 | 1924843..1924935 | - | 93 | WP_072833197.1 | DUF3265 domain-containing protein | - |
VP_RS08805 (VP1824) | 1924950..1925483 | - | 534 | WP_005483198.1 | hypothetical protein | - |
VP_RS08810 | 1925581..1925673 | - | 93 | WP_005464677.1 | DUF3265 domain-containing protein | - |
VP_RS08815 (VP1825) | 1925696..1926466 | - | 771 | WP_005464405.1 | CBS domain-containing protein | - |
VP_RS08820 (VP1826) | 1926537..1927358 | - | 822 | WP_005464673.1 | DUF1669 domain-containing protein | - |
VP_RS23585 | 1927333..1927473 | - | 141 | WP_162828790.1 | hypothetical protein | - |
VP_RS08830 (VP1827) | 1927502..1928044 | - | 543 | WP_005464345.1 | GNAT family N-acetyltransferase | - |
VP_RS23705 | 1928077..1928166 | - | 90 | WP_072833190.1 | DUF3265 domain-containing protein | - |
VP_RS08840 (VP1828) | 1928198..1928470 | - | 273 | WP_005462157.1 | nicotinamide mononucleotide transporter | - |
VP_RS08845 | 1928497..1928664 | - | 168 | WP_078532952.1 | DUF3265 domain-containing protein | - |
VP_RS08850 (VP1829) | 1928666..1928950 | + | 285 | WP_005483268.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
VP_RS08855 (VP1830) | 1928947..1929225 | + | 279 | WP_005483280.1 | type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family | Toxin |
VP_RS08860 | 1929254..1929364 | - | 111 | WP_082798391.1 | DUF3265 domain-containing protein | - |
VP_RS08865 (VP1831) | 1929372..1929656 | - | 285 | WP_005483310.1 | nucleotide pyrophosphohydrolase | - |
VP_RS08870 | 1929701..1929823 | - | 123 | WP_078511351.1 | DUF3265 domain-containing protein | - |
VP_RS08875 (VP1832) | 1929820..1930296 | - | 477 | WP_005483302.1 | GNAT family N-acetyltransferase | - |
VP_RS08880 (VP1833) | 1930324..1930425 | - | 102 | WP_011105959.1 | DUF3265 domain-containing protein | - |
VP_RS08885 (VP1834) | 1930441..1930726 | - | 286 | Protein_1729 | nucleotide pyrophosphohydrolase | - |
VP_RS08890 | 1930888..1931355 | - | 468 | WP_005464650.1 | cold shock domain-containing protein | - |
VP_RS08895 | 1931456..1931533 | - | 78 | WP_072833152.1 | DUF3265 domain-containing protein | - |
VP_RS08900 (VP1835) | 1931562..1931936 | - | 375 | WP_005483170.1 | hypothetical protein | - |
VP_RS08905 | 1932074..1932583 | - | 510 | WP_005483274.1 | ClbS/DfsB family four-helix bundle protein | - |
VP_RS08910 (VP1838) | 1933192..1933284 | - | 93 | WP_011105963.1 | DUF3265 domain-containing protein | - |
VP_RS08915 (VP1839) | 1933312..1933824 | - | 513 | WP_024699234.1 | hypothetical protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Integron | - | - | 1901751..1949243 | 47492 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10937.66 Da Isoelectric Point: 4.2397
>T20885 WP_005483280.1 NC_004603:1928947-1929225 [Vibrio parahaemolyticus RIMD 2210633]
MILWEEESLNDREKIFEFLYDFNPDAAEKTDNLIEANVENLLEQLLMGVQRDGVRGRLLIIPEISMIVSYWIEGDIIRIM
RVLHQKQKFPMD
MILWEEESLNDREKIFEFLYDFNPDAAEKTDNLIEANVENLLEQLLMGVQRDGVRGRLLIIPEISMIVSYWIEGDIIRIM
RVLHQKQKFPMD
Download Length: 279 bp
>T20885 NC_004603:1928947-1929225 [Vibrio parahaemolyticus RIMD 2210633]
ATGATTTTATGGGAAGAAGAGTCACTTAATGATCGTGAAAAGATCTTTGAGTTTCTCTATGACTTTAACCCTGATGCGGC
AGAAAAAACTGACAACCTCATTGAAGCAAACGTAGAAAACTTGCTAGAGCAGCTTCTTATGGGTGTACAGCGAGACGGTG
TTCGTGGGCGATTACTTATAATTCCTGAGATTTCGATGATCGTCTCCTATTGGATCGAAGGCGACATTATCCGAATCATG
CGCGTACTCCACCAGAAACAAAAATTTCCTATGGATTGA
ATGATTTTATGGGAAGAAGAGTCACTTAATGATCGTGAAAAGATCTTTGAGTTTCTCTATGACTTTAACCCTGATGCGGC
AGAAAAAACTGACAACCTCATTGAAGCAAACGTAGAAAACTTGCTAGAGCAGCTTCTTATGGGTGTACAGCGAGACGGTG
TTCGTGGGCGATTACTTATAATTCCTGAGATTTCGATGATCGTCTCCTATTGGATCGAAGGCGACATTATCCGAATCATG
CGCGTACTCCACCAGAAACAAAAATTTCCTATGGATTGA
Antitoxin
Download Length: 95 a.a. Molecular weight: 11027.32 Da Isoelectric Point: 8.0517
>AT20885 WP_005483268.1 NC_004603:1928666-1928950 [Vibrio parahaemolyticus RIMD 2210633]
MDTRIQFRVDEETKRLAQQMAESQGRTLSDACRELTEQLAEQQRKSLSHDAWLTEQVNLAFEKFDSGKSVFVEHQTAKSQ
MEERKARIRNRGKQ
MDTRIQFRVDEETKRLAQQMAESQGRTLSDACRELTEQLAEQQRKSLSHDAWLTEQVNLAFEKFDSGKSVFVEHQTAKSQ
MEERKARIRNRGKQ
Download Length: 285 bp
>AT20885 NC_004603:1928666-1928950 [Vibrio parahaemolyticus RIMD 2210633]
ATGGACACTAGAATTCAATTTCGTGTTGATGAAGAAACAAAACGCCTAGCTCAACAAATGGCTGAGAGCCAAGGTCGCAC
ACTAAGTGATGCTTGCCGTGAACTTACTGAGCAACTCGCTGAACAACAAAGAAAATCATTATCTCACGATGCGTGGTTAA
CTGAACAAGTAAACCTAGCATTTGAGAAGTTTGACTCAGGAAAATCCGTTTTCGTTGAGCACCAAACTGCTAAATCTCAA
ATGGAAGAACGCAAAGCCAGAATCCGTAATCGAGGTAAGCAATGA
ATGGACACTAGAATTCAATTTCGTGTTGATGAAGAAACAAAACGCCTAGCTCAACAAATGGCTGAGAGCCAAGGTCGCAC
ACTAAGTGATGCTTGCCGTGAACTTACTGAGCAACTCGCTGAACAACAAAGAAAATCATTATCTCACGATGCGTGGTTAA
CTGAACAAGTAAACCTAGCATTTGAGAAGTTTGACTCAGGAAAATCCGTTTTCGTTGAGCACCAAACTGCTAAATCTCAA
ATGGAAGAACGCAAAGCCAGAATCCGTAATCGAGGTAAGCAATGA