Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relB-yefM/YoeB-RelB
Location 1352219..1352735 Replicon chromosome
Accession NZ_CP102434
Organism Vibrio parahaemolyticus strain RMDVP1

Toxin (Protein)


Gene name relB Uniprot ID U2ZZV8
Locus tag NR793_RS14785 Protein ID WP_005464459.1
Coordinates 1352466..1352735 (+) Length 90 a.a.

Antitoxin (Protein)


Gene name yefM Uniprot ID A0A7W4CB60
Locus tag NR793_RS14780 Protein ID WP_005483180.1
Coordinates 1352219..1352473 (+) Length 85 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NR793_RS14720 (NR793_14745) 1347240..1347512 + 273 WP_005462157.1 nicotinamide mononucleotide transporter -
NR793_RS14725 (NR793_14750) 1347544..1347633 + 90 WP_072833190.1 DUF3265 domain-containing protein -
NR793_RS14730 (NR793_14755) 1347666..1348208 + 543 WP_005464345.1 GNAT family N-acetyltransferase -
NR793_RS14735 (NR793_14760) 1348205..1348270 + 66 Protein_1179 DUF3265 domain-containing protein -
NR793_RS14740 (NR793_14765) 1348352..1349173 + 822 WP_005464673.1 phospholipase D-like domain-containing protein -
NR793_RS14745 (NR793_14770) 1349158..1349241 + 84 Protein_1181 DUF3265 domain-containing protein -
NR793_RS14750 (NR793_14775) 1349307..1350014 + 708 WP_005490672.1 CBS domain-containing protein -
NR793_RS14755 (NR793_14780) 1350001..1350129 + 129 WP_017420780.1 DUF3265 domain-containing protein -
NR793_RS14760 (NR793_14785) 1350158..1350760 + 603 WP_021451206.1 hypothetical protein -
NR793_RS14765 (NR793_14790) 1350775..1350867 + 93 WP_072833197.1 DUF3265 domain-containing protein -
NR793_RS14770 (NR793_14795) 1350906..1352000 + 1095 WP_079749463.1 hypothetical protein -
NR793_RS14775 (NR793_14800) 1352024..1352116 + 93 WP_011105955.1 DUF3265 domain-containing protein -
NR793_RS14780 (NR793_14805) 1352219..1352473 + 255 WP_005483180.1 type II toxin-antitoxin system prevent-host-death family antitoxin Antitoxin
NR793_RS14785 (NR793_14810) 1352466..1352735 + 270 WP_005464459.1 Txe/YoeB family addiction module toxin Toxin
NR793_RS14790 (NR793_14815) 1352900..1353280 + 381 WP_005467118.1 energy transducer TonB -
NR793_RS14795 (NR793_14820) 1353308..1353397 + 90 WP_072833196.1 DUF3265 domain-containing protein -
NR793_RS14800 (NR793_14825) 1353975..1354421 + 447 WP_024699215.1 hypothetical protein -
NR793_RS14805 (NR793_14830) 1354452..1354541 + 90 WP_072833195.1 DUF3265 domain-containing protein -
NR793_RS14810 (NR793_14835) 1354574..1354975 + 402 WP_005483261.1 HIT family protein -
NR793_RS14815 (NR793_14840) 1355010..1355102 + 93 WP_017045846.1 DUF3265 domain-containing protein -
NR793_RS14820 (NR793_14845) 1355199..1355504 - 306 WP_080252734.1 hypothetical protein -
NR793_RS14825 (NR793_14850) 1355633..1355722 + 90 WP_072833118.1 DUF3265 domain-containing protein -
NR793_RS14830 (NR793_14855) 1355844..1356320 + 477 WP_017449567.1 hypothetical protein -
NR793_RS14835 (NR793_14860) 1356310..1356402 + 93 WP_072833112.1 DUF3265 domain-containing protein -
NR793_RS14840 (NR793_14865) 1356440..1356829 + 390 WP_005490691.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 1326528..1373959 47431
inside Integron - - 1327052..1373959 46907


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin YoeB

(10-89)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-74)


Sequences

Toxin        


Download         Length: 90 a.a.        Molecular weight: 10614.96 Da        Isoelectric Point: 7.9816

>T253630 WP_005464459.1 NZ_CP102434:1352466-1352735 [Vibrio parahaemolyticus]
MSSSQRLLSWTDDAWDDYLYWQTQDKKTLKRINKLINDVKRSPFEGIGKPEPLKENLSGFWSRRIDDTNRLVYAVDDQAI
TIISCRYHY

Download         Length: 270 bp

Antitoxin


Download         Length: 85 a.a.        Molecular weight: 9481.66 Da        Isoelectric Point: 5.0623

>AT253630 WP_005483180.1 NZ_CP102434:1352219-1352473 [Vibrio parahaemolyticus]
MRIVSFTEARNGLKAVLDGVVNDADTTVITRRDSEDAVVMSLDYYNSLMETVHLLRSPQNVEHLNRSIAQYRAGKTTARE
LIDE

Download         Length: 255 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB U2ZZV8

Antitoxin

Source ID Structure
AlphaFold DB A0A7W4CB60

References