Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relB-yefM/YoeB-RelB |
Location | 1922975..1923491 | Replicon | chromosome |
Accession | NC_004603 | ||
Organism | Vibrio parahaemolyticus RIMD 2210633 |
Toxin (Protein)
Gene name | relB | Uniprot ID | U2ZZV8 |
Locus tag | VP_RS08780 | Protein ID | WP_005464459.1 |
Coordinates | 1922975..1923244 (-) | Length | 90 a.a. |
Antitoxin (Protein)
Gene name | yefM | Uniprot ID | A0A7W4CB60 |
Locus tag | VP_RS08785 | Protein ID | WP_005483180.1 |
Coordinates | 1923237..1923491 (-) | Length | 85 a.a. |
Genomic Context
Location: 1918881..1919270 (390 bp)
Type: Others
Protein ID: WP_005490691.1
Type: Others
Protein ID: WP_005490691.1
Location: 1919308..1919400 (93 bp)
Type: Others
Protein ID: WP_072833112.1
Type: Others
Protein ID: WP_072833112.1
Location: 1919390..1919866 (477 bp)
Type: Others
Protein ID: WP_017449567.1
Type: Others
Protein ID: WP_017449567.1
Location: 1919988..1920119 (132 bp)
Type: Others
Protein ID: WP_078532947.1
Type: Others
Protein ID: WP_078532947.1
Location: 1920199..1920405 (207 bp)
Type: Others
Protein ID: WP_005462168.1
Type: Others
Protein ID: WP_005462168.1
Location: 1920608..1920700 (93 bp)
Type: Others
Protein ID: WP_017045846.1
Type: Others
Protein ID: WP_017045846.1
Location: 1920735..1921136 (402 bp)
Type: Others
Protein ID: WP_005483261.1
Type: Others
Protein ID: WP_005483261.1
Location: 1921169..1921285 (117 bp)
Type: Others
Protein ID: WP_161609362.1
Type: Others
Protein ID: WP_161609362.1
Location: 1921289..1921735 (447 bp)
Type: Others
Protein ID: WP_024699215.1
Type: Others
Protein ID: WP_024699215.1
Location: 1922313..1922402 (90 bp)
Type: Others
Protein ID: WP_072833196.1
Type: Others
Protein ID: WP_072833196.1
Location: 1922430..1922810 (381 bp)
Type: Others
Protein ID: WP_005467118.1
Type: Others
Protein ID: WP_005467118.1
Location: 1922975..1923244 (270 bp)
Type: Toxin
Protein ID: WP_005464459.1
Type: Toxin
Protein ID: WP_005464459.1
Location: 1923237..1923491 (255 bp)
Type: Antitoxin
Protein ID: WP_005483180.1
Type: Antitoxin
Protein ID: WP_005483180.1
Location: 1923594..1923686 (93 bp)
Type: Others
Protein ID: WP_011105955.1
Type: Others
Protein ID: WP_011105955.1
Location: 1923710..1924879 (1170 bp)
Type: Others
Protein ID: WP_005483289.1
Type: Others
Protein ID: WP_005483289.1
Location: 1924843..1924935 (93 bp)
Type: Others
Protein ID: WP_072833197.1
Type: Others
Protein ID: WP_072833197.1
Location: 1924950..1925483 (534 bp)
Type: Others
Protein ID: WP_005483198.1
Type: Others
Protein ID: WP_005483198.1
Location: 1925581..1925673 (93 bp)
Type: Others
Protein ID: WP_005464677.1
Type: Others
Protein ID: WP_005464677.1
Location: 1925696..1926466 (771 bp)
Type: Others
Protein ID: WP_005464405.1
Type: Others
Protein ID: WP_005464405.1
Location: 1926537..1927358 (822 bp)
Type: Others
Protein ID: WP_005464673.1
Type: Others
Protein ID: WP_005464673.1
Location: 1927333..1927473 (141 bp)
Type: Others
Protein ID: WP_162828790.1
Type: Others
Protein ID: WP_162828790.1
Location: 1927502..1928044 (543 bp)
Type: Others
Protein ID: WP_005464345.1
Type: Others
Protein ID: WP_005464345.1
Location: 1928077..1928166 (90 bp)
Type: Others
Protein ID: WP_072833190.1
Type: Others
Protein ID: WP_072833190.1
Location: 1928198..1928470 (273 bp)
Type: Others
Protein ID: WP_005462157.1
Type: Others
Protein ID: WP_005462157.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
VP_RS08725 (VP1813) | 1918881..1919270 | - | 390 | WP_005490691.1 | hypothetical protein | - |
VP_RS08730 | 1919308..1919400 | - | 93 | WP_072833112.1 | DUF3265 domain-containing protein | - |
VP_RS08735 (VP1814) | 1919390..1919866 | - | 477 | WP_017449567.1 | hypothetical protein | - |
VP_RS08740 | 1919988..1920119 | - | 132 | WP_078532947.1 | DUF3265 domain-containing protein | - |
VP_RS08745 | 1920199..1920405 | - | 207 | WP_005462168.1 | hypothetical protein | - |
VP_RS08750 | 1920608..1920700 | - | 93 | WP_017045846.1 | DUF3265 domain-containing protein | - |
VP_RS08755 (VP1816) | 1920735..1921136 | - | 402 | WP_005483261.1 | HIT family protein | - |
VP_RS08760 | 1921169..1921285 | - | 117 | WP_161609362.1 | DUF3265 domain-containing protein | - |
VP_RS08765 (VP1817) | 1921289..1921735 | - | 447 | WP_024699215.1 | hypothetical protein | - |
VP_RS08770 | 1922313..1922402 | - | 90 | WP_072833196.1 | DUF3265 domain-containing protein | - |
VP_RS08775 (VP1819) | 1922430..1922810 | - | 381 | WP_005467118.1 | energy transducer TonB | - |
VP_RS08780 (VP1820) | 1922975..1923244 | - | 270 | WP_005464459.1 | Txe/YoeB family addiction module toxin | Toxin |
VP_RS08785 (VP1821) | 1923237..1923491 | - | 255 | WP_005483180.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
VP_RS08790 (VP1822) | 1923594..1923686 | - | 93 | WP_011105955.1 | DUF3265 domain-containing protein | - |
VP_RS08795 (VP1823) | 1923710..1924879 | - | 1170 | WP_005483289.1 | hypothetical protein | - |
VP_RS08800 | 1924843..1924935 | - | 93 | WP_072833197.1 | DUF3265 domain-containing protein | - |
VP_RS08805 (VP1824) | 1924950..1925483 | - | 534 | WP_005483198.1 | hypothetical protein | - |
VP_RS08810 | 1925581..1925673 | - | 93 | WP_005464677.1 | DUF3265 domain-containing protein | - |
VP_RS08815 (VP1825) | 1925696..1926466 | - | 771 | WP_005464405.1 | CBS domain-containing protein | - |
VP_RS08820 (VP1826) | 1926537..1927358 | - | 822 | WP_005464673.1 | DUF1669 domain-containing protein | - |
VP_RS23585 | 1927333..1927473 | - | 141 | WP_162828790.1 | hypothetical protein | - |
VP_RS08830 (VP1827) | 1927502..1928044 | - | 543 | WP_005464345.1 | GNAT family N-acetyltransferase | - |
VP_RS23705 | 1928077..1928166 | - | 90 | WP_072833190.1 | DUF3265 domain-containing protein | - |
VP_RS08840 (VP1828) | 1928198..1928470 | - | 273 | WP_005462157.1 | nicotinamide mononucleotide transporter | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Integron | - | - | 1901751..1949243 | 47492 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 90 a.a. Molecular weight: 10614.96 Da Isoelectric Point: 7.9816
>T20884 WP_005464459.1 NC_004603:c1923244-1922975 [Vibrio parahaemolyticus RIMD 2210633]
MSSSQRLLSWTDDAWDDYLYWQTQDKKTLKRINKLINDVKRSPFEGIGKPEPLKENLSGFWSRRIDDTNRLVYAVDDQAI
TIISCRYHY
MSSSQRLLSWTDDAWDDYLYWQTQDKKTLKRINKLINDVKRSPFEGIGKPEPLKENLSGFWSRRIDDTNRLVYAVDDQAI
TIISCRYHY
Download Length: 270 bp
>T20884 NC_004603:c1923244-1922975 [Vibrio parahaemolyticus RIMD 2210633]
ATGAGTAGTAGTCAACGTTTATTATCGTGGACTGATGATGCTTGGGATGACTACCTGTATTGGCAAACTCAAGACAAGAA
AACACTCAAGCGCATCAATAAACTCATCAATGATGTTAAGCGCTCTCCATTTGAGGGCATTGGTAAACCAGAGCCGTTAA
AAGAGAACTTATCTGGTTTTTGGTCTCGTCGTATTGATGATACTAATAGGCTTGTTTACGCAGTCGATGATCAAGCGATA
ACGATAATTTCATGTCGTTACCACTACTAA
ATGAGTAGTAGTCAACGTTTATTATCGTGGACTGATGATGCTTGGGATGACTACCTGTATTGGCAAACTCAAGACAAGAA
AACACTCAAGCGCATCAATAAACTCATCAATGATGTTAAGCGCTCTCCATTTGAGGGCATTGGTAAACCAGAGCCGTTAA
AAGAGAACTTATCTGGTTTTTGGTCTCGTCGTATTGATGATACTAATAGGCTTGTTTACGCAGTCGATGATCAAGCGATA
ACGATAATTTCATGTCGTTACCACTACTAA
Antitoxin
Download Length: 85 a.a. Molecular weight: 9481.66 Da Isoelectric Point: 5.0623
>AT20884 WP_005483180.1 NC_004603:c1923491-1923237 [Vibrio parahaemolyticus RIMD 2210633]
MRIVSFTEARNGLKAVLDGVVNDADTTVITRRDSEDAVVMSLDYYNSLMETVHLLRSPQNVEHLNRSIAQYRAGKTTARE
LIDE
MRIVSFTEARNGLKAVLDGVVNDADTTVITRRDSEDAVVMSLDYYNSLMETVHLLRSPQNVEHLNRSIAQYRAGKTTARE
LIDE
Download Length: 255 bp
>AT20884 NC_004603:c1923491-1923237 [Vibrio parahaemolyticus RIMD 2210633]
ATGAGAATCGTATCTTTTACTGAAGCTAGAAATGGTCTCAAAGCTGTTTTAGACGGTGTAGTTAATGATGCTGATACAAC
AGTTATTACACGCCGTGATTCTGAGGATGCAGTGGTTATGTCTTTAGACTACTACAATAGCCTTATGGAGACTGTTCATT
TACTACGCTCTCCTCAAAACGTTGAACACCTAAACCGTTCGATAGCACAGTACCGCGCTGGTAAAACAACAGCACGAGAG
TTAATTGATGAGTAG
ATGAGAATCGTATCTTTTACTGAAGCTAGAAATGGTCTCAAAGCTGTTTTAGACGGTGTAGTTAATGATGCTGATACAAC
AGTTATTACACGCCGTGATTCTGAGGATGCAGTGGTTATGTCTTTAGACTACTACAATAGCCTTATGGAGACTGTTCATT
TACTACGCTCTCCTCAAAACGTTGAACACCTAAACCGTTCGATAGCACAGTACCGCGCTGGTAAAACAACAGCACGAGAG
TTAATTGATGAGTAG
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | U2ZZV8 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7W4CB60 |