253628

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE-RelB
Location 1340767..1341326 Replicon chromosome
Accession NZ_CP102434
Organism Vibrio parahaemolyticus strain RMDVP1

Toxin (Protein)


Gene name relE Uniprot ID Q87NM5
Locus tag NR793_RS14630 Protein ID WP_005483176.1
Coordinates 1340767..1341045 (-) Length 93 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A0L8TUJ0
Locus tag NR793_RS14635 Protein ID WP_005483196.1
Coordinates 1341042..1341326 (-) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NR793_RS14580 (NR793_14605) 1336258..1336350 + 93 WP_072833185.1 DUF3265 domain-containing protein -
NR793_RS14585 (NR793_14610) 1336395..1336811 + 417 WP_021451209.1 GNAT family N-acetyltransferase -
NR793_RS14590 (NR793_14615) 1336840..1336929 + 90 WP_072833189.1 DUF3265 domain-containing protein -
NR793_RS14595 (NR793_14620) 1337066..1337305 + 240 WP_005483258.1 hypothetical protein -
NR793_RS14600 (NR793_14625) 1337444..1337716 + 273 WP_029853404.1 hypothetical protein -
NR793_RS14605 (NR793_14630) 1337863..1338537 + 675 WP_005483286.1 hypothetical protein -
NR793_RS14610 (NR793_14635) 1338749..1339147 + 399 WP_005483218.1 lysozyme inhibitor LprI family protein -
NR793_RS14615 (NR793_14640) 1339281..1339955 + 675 WP_005483207.1 hypothetical protein -
NR793_RS14620 (NR793_14645) 1340094..1340615 + 522 WP_005483288.1 GNAT family N-acetyltransferase -
NR793_RS14625 (NR793_14650) 1340622..1340738 + 117 WP_080931826.1 DUF3265 domain-containing protein -
NR793_RS14630 (NR793_14655) 1340767..1341045 - 279 WP_005483176.1 type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family Toxin
NR793_RS14635 (NR793_14660) 1341042..1341326 - 285 WP_005483196.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
NR793_RS14640 (NR793_14665) 1341403..1341494 + 92 Protein_1160 DUF3265 domain-containing protein -
NR793_RS14645 (NR793_14670) 1341523..1342161 + 639 WP_005483241.1 hypothetical protein -
NR793_RS14650 (NR793_14675) 1342155..1342223 + 69 Protein_1162 DUF3265 domain-containing protein -
NR793_RS14655 (NR793_14680) 1342295..1342876 + 582 WP_005483293.1 hypothetical protein -
NR793_RS14660 (NR793_14685) 1343018..1343530 + 513 WP_024699234.1 hypothetical protein -
NR793_RS14665 (NR793_14690) 1343558..1343650 + 93 WP_011105963.1 DUF3265 domain-containing protein -
NR793_RS14670 (NR793_14695) 1344259..1344768 + 510 WP_005483274.1 ClbS/DfsB family four-helix bundle protein -
NR793_RS14675 (NR793_14700) 1344906..1345280 + 375 WP_005483170.1 hypothetical protein -
NR793_RS14680 (NR793_14705) 1345276..1345386 + 111 Protein_1168 DUF3265 domain-containing protein -
NR793_RS14685 (NR793_14710) 1345414..1345890 + 477 WP_005483302.1 GNAT family N-acetyltransferase -
NR793_RS14690 (NR793_14715) 1345920..1346009 + 90 WP_072833192.1 DUF3265 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 1326528..1373959 47431
inside Integron - - 1327052..1373959 46907


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(1-89)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(5-45)


Sequences

Toxin        


Download         Length: 93 a.a.        Molecular weight: 10906.55 Da        Isoelectric Point: 4.3430

>T253628 WP_005483176.1 NZ_CP102434:c1341045-1340767 [Vibrio parahaemolyticus]
MILWEEESLNDREEIFEFLYDFNPDAAEKTDNLIEAKVENLLKQPLMGVQRDGIRGRLLIIPEISMIVSYWVEGDIIRVM
RVQHQKQKFPTD

Download         Length: 279 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 11083.43 Da        Isoelectric Point: 9.2167

>AT253628 WP_005483196.1 NZ_CP102434:c1341326-1341042 [Vibrio parahaemolyticus]
MDTRIQFRVDEETKRLAQQMAESQGRTLSDACRELTEQLAEQQRKTLSHDAWLTEQVNLAFEKFDSGKSVFLEHQTAKSR
MEERKARIRNRGKQ

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q87NM5

Antitoxin

Source ID Structure
AlphaFold DB A0A0L8TUJ0

References