253629

Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type II Classification (family/domain) relBE/RelE-RelB
Location 1346485..1347044 Replicon chromosome
Accession NZ_CP102434
Organism Vibrio parahaemolyticus strain RMDVP1

Toxin (Protein)


Gene name relE Uniprot ID Q87NN8
Locus tag NR793_RS14705 Protein ID WP_005483280.1
Coordinates 1346485..1346763 (-) Length 93 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID Q87NN9
Locus tag NR793_RS14710 Protein ID WP_005483268.1
Coordinates 1346760..1347044 (-) Length 95 a.a.

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NR793_RS14645 (NR793_14670) 1341523..1342161 + 639 WP_005483241.1 hypothetical protein -
NR793_RS14650 (NR793_14675) 1342155..1342223 + 69 Protein_1162 DUF3265 domain-containing protein -
NR793_RS14655 (NR793_14680) 1342295..1342876 + 582 WP_005483293.1 hypothetical protein -
NR793_RS14660 (NR793_14685) 1343018..1343530 + 513 WP_024699234.1 hypothetical protein -
NR793_RS14665 (NR793_14690) 1343558..1343650 + 93 WP_011105963.1 DUF3265 domain-containing protein -
NR793_RS14670 (NR793_14695) 1344259..1344768 + 510 WP_005483274.1 ClbS/DfsB family four-helix bundle protein -
NR793_RS14675 (NR793_14700) 1344906..1345280 + 375 WP_005483170.1 hypothetical protein -
NR793_RS14680 (NR793_14705) 1345276..1345386 + 111 Protein_1168 DUF3265 domain-containing protein -
NR793_RS14685 (NR793_14710) 1345414..1345890 + 477 WP_005483302.1 GNAT family N-acetyltransferase -
NR793_RS14690 (NR793_14715) 1345920..1346009 + 90 WP_072833192.1 DUF3265 domain-containing protein -
NR793_RS14695 (NR793_14720) 1346054..1346338 + 285 WP_005483310.1 MazG nucleotide pyrophosphohydrolase domain-containing protein -
NR793_RS14700 (NR793_14725) 1346346..1346456 + 111 WP_082798391.1 DUF3265 domain-containing protein -
NR793_RS14705 (NR793_14730) 1346485..1346763 - 279 WP_005483280.1 type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family Toxin
NR793_RS14710 (NR793_14735) 1346760..1347044 - 285 WP_005483268.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
NR793_RS14715 (NR793_14740) 1347121..1347213 + 93 WP_072833191.1 DUF3265 domain-containing protein -
NR793_RS14720 (NR793_14745) 1347240..1347512 + 273 WP_005462157.1 nicotinamide mononucleotide transporter -
NR793_RS14725 (NR793_14750) 1347544..1347633 + 90 WP_072833190.1 DUF3265 domain-containing protein -
NR793_RS14730 (NR793_14755) 1347666..1348208 + 543 WP_005464345.1 GNAT family N-acetyltransferase -
NR793_RS14735 (NR793_14760) 1348205..1348270 + 66 Protein_1179 DUF3265 domain-containing protein -
NR793_RS14740 (NR793_14765) 1348352..1349173 + 822 WP_005464673.1 phospholipase D-like domain-containing protein -
NR793_RS14745 (NR793_14770) 1349158..1349241 + 84 Protein_1181 DUF3265 domain-containing protein -
NR793_RS14750 (NR793_14775) 1349307..1350014 + 708 WP_005490672.1 CBS domain-containing protein -
NR793_RS14755 (NR793_14780) 1350001..1350129 + 129 WP_017420780.1 DUF3265 domain-containing protein -
NR793_RS14760 (NR793_14785) 1350158..1350760 + 603 WP_021451206.1 hypothetical protein -
NR793_RS14765 (NR793_14790) 1350775..1350867 + 93 WP_072833197.1 DUF3265 domain-containing protein -
NR793_RS14770 (NR793_14795) 1350906..1352000 + 1095 WP_079749463.1 hypothetical protein -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 1326528..1373959 47431
inside Integron - - 1327052..1373959 46907


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.



Sequences


Toxin        


Download         Length: 93 a.a.        Molecular weight: 10937.66 Da        Isoelectric Point: 4.2397

>T253629 WP_005483280.1 NZ_CP102434:c1346763-1346485 [Vibrio parahaemolyticus]
MILWEEESLNDREKIFEFLYDFNPDAAEKTDNLIEANVENLLEQLLMGVQRDGVRGRLLIIPEISMIVSYWIEGDIIRIM
RVLHQKQKFPMD

Download         Length: 279 bp


Antitoxin


Download         Length: 95 a.a.        Molecular weight: 11027.32 Da        Isoelectric Point: 8.0517

>AT253629 WP_005483268.1 NZ_CP102434:c1347044-1346760 [Vibrio parahaemolyticus]
MDTRIQFRVDEETKRLAQQMAESQGRTLSDACRELTEQLAEQQRKSLSHDAWLTEQVNLAFEKFDSGKSVFVEHQTAKSQ
MEERKARIRNRGKQ

Download         Length: 285 bp


Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure
AlphaFold DB Q87NN8


Antitoxin

Source ID Structure
AlphaFold DB Q87NN9

References