Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelE-RelB |
| Location | 1346485..1347044 | Replicon | chromosome |
| Accession | NZ_CP102434 | ||
| Organism | Vibrio parahaemolyticus strain RMDVP1 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | Q87NN8 |
| Locus tag | NR793_RS14705 | Protein ID | WP_005483280.1 |
| Coordinates | 1346485..1346763 (-) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | Q87NN9 |
| Locus tag | NR793_RS14710 | Protein ID | WP_005483268.1 |
| Coordinates | 1346760..1347044 (-) | Length | 95 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NR793_RS14645 (NR793_14670) | 1341523..1342161 | + | 639 | WP_005483241.1 | hypothetical protein | - |
| NR793_RS14650 (NR793_14675) | 1342155..1342223 | + | 69 | Protein_1162 | DUF3265 domain-containing protein | - |
| NR793_RS14655 (NR793_14680) | 1342295..1342876 | + | 582 | WP_005483293.1 | hypothetical protein | - |
| NR793_RS14660 (NR793_14685) | 1343018..1343530 | + | 513 | WP_024699234.1 | hypothetical protein | - |
| NR793_RS14665 (NR793_14690) | 1343558..1343650 | + | 93 | WP_011105963.1 | DUF3265 domain-containing protein | - |
| NR793_RS14670 (NR793_14695) | 1344259..1344768 | + | 510 | WP_005483274.1 | ClbS/DfsB family four-helix bundle protein | - |
| NR793_RS14675 (NR793_14700) | 1344906..1345280 | + | 375 | WP_005483170.1 | hypothetical protein | - |
| NR793_RS14680 (NR793_14705) | 1345276..1345386 | + | 111 | Protein_1168 | DUF3265 domain-containing protein | - |
| NR793_RS14685 (NR793_14710) | 1345414..1345890 | + | 477 | WP_005483302.1 | GNAT family N-acetyltransferase | - |
| NR793_RS14690 (NR793_14715) | 1345920..1346009 | + | 90 | WP_072833192.1 | DUF3265 domain-containing protein | - |
| NR793_RS14695 (NR793_14720) | 1346054..1346338 | + | 285 | WP_005483310.1 | MazG nucleotide pyrophosphohydrolase domain-containing protein | - |
| NR793_RS14700 (NR793_14725) | 1346346..1346456 | + | 111 | WP_082798391.1 | DUF3265 domain-containing protein | - |
| NR793_RS14705 (NR793_14730) | 1346485..1346763 | - | 279 | WP_005483280.1 | type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family | Toxin |
| NR793_RS14710 (NR793_14735) | 1346760..1347044 | - | 285 | WP_005483268.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| NR793_RS14715 (NR793_14740) | 1347121..1347213 | + | 93 | WP_072833191.1 | DUF3265 domain-containing protein | - |
| NR793_RS14720 (NR793_14745) | 1347240..1347512 | + | 273 | WP_005462157.1 | nicotinamide mononucleotide transporter | - |
| NR793_RS14725 (NR793_14750) | 1347544..1347633 | + | 90 | WP_072833190.1 | DUF3265 domain-containing protein | - |
| NR793_RS14730 (NR793_14755) | 1347666..1348208 | + | 543 | WP_005464345.1 | GNAT family N-acetyltransferase | - |
| NR793_RS14735 (NR793_14760) | 1348205..1348270 | + | 66 | Protein_1179 | DUF3265 domain-containing protein | - |
| NR793_RS14740 (NR793_14765) | 1348352..1349173 | + | 822 | WP_005464673.1 | phospholipase D-like domain-containing protein | - |
| NR793_RS14745 (NR793_14770) | 1349158..1349241 | + | 84 | Protein_1181 | DUF3265 domain-containing protein | - |
| NR793_RS14750 (NR793_14775) | 1349307..1350014 | + | 708 | WP_005490672.1 | CBS domain-containing protein | - |
| NR793_RS14755 (NR793_14780) | 1350001..1350129 | + | 129 | WP_017420780.1 | DUF3265 domain-containing protein | - |
| NR793_RS14760 (NR793_14785) | 1350158..1350760 | + | 603 | WP_021451206.1 | hypothetical protein | - |
| NR793_RS14765 (NR793_14790) | 1350775..1350867 | + | 93 | WP_072833197.1 | DUF3265 domain-containing protein | - |
| NR793_RS14770 (NR793_14795) | 1350906..1352000 | + | 1095 | WP_079749463.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 1326528..1373959 | 47431 | |
| inside | Integron | - | - | 1327052..1373959 | 46907 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10937.66 Da Isoelectric Point: 4.2397
>T253629 WP_005483280.1 NZ_CP102434:c1346763-1346485 [Vibrio parahaemolyticus]
MILWEEESLNDREKIFEFLYDFNPDAAEKTDNLIEANVENLLEQLLMGVQRDGVRGRLLIIPEISMIVSYWIEGDIIRIM
RVLHQKQKFPMD
MILWEEESLNDREKIFEFLYDFNPDAAEKTDNLIEANVENLLEQLLMGVQRDGVRGRLLIIPEISMIVSYWIEGDIIRIM
RVLHQKQKFPMD
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|