Detailed information of regulator


Summary

Regulator ID REG0369 experimental
Regulator type protein
Regulatory pathway (from literatures) TCS-RR
KEGG pathway (determined by BlastKOALA) Two-component system (map02020)
Related T6SS T6SS00790 experimental (Type i1)
Strain Vibrio cholerae V52
Replicon chromosome
Sequence Protein sequence (230 a.a.); Nucleotide sequence (690 bp)
Description ΔwigR V52 was greatly impaired in its ability to kill E. coli prey. This reduced killing activity was reflected at both the protein and messenger RNA levels, as ΔwigR V52 produced fewer T6SS needles and had reduced expression of T6SS genes, hcp and vipA, compared with the WT.
Reference

External database links

Locus tag (Gene) VCV52_RS14135 (wigR/phoB/vxrB)
Coordinates (Strand) 201806..202495 (-)
NCBI ID 446013262
RefSeq NZ_KQ410503
Uniprot ID Q9KU11_VIBCH, A0A0X1KUP3_VIBCO, Q19LH9_VIBC3, D7HER4_VIBCL, A0A0K9UVD4_VIBCL, A0A0H3PW59_VIBCL, C3LSX2_VIBCM, A0A085TF90_VIBCL, D2YHP6_VIBMI, A0A1D8SDF5_VIBMI
KEGG ID vcm:VCM66_0677, vcq:EN18_07005, vcx:VAA049_2973, vch:VC_0719, vcz:VAB027_1380, vco:VC0395_A0253
KEGG pathway (determined by BlastKOALA) map02020
PDB ID -

  Target
Target Regulation (↓/↑) Target sequence
T6SS transcription level -

Pfam domain hit(s) of regulator

Domain Pfam ID E-value Aligned region
Response_reg PF00072.26 5.7e-29 5..116
Trans_reg_C PF00486.30 1.4e-28 151..225

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-229 MSRRILVVEDEAPIREMLCFVLEQKGYQAVEAEDYDSAMSKLAEPFPDLVLLDWMLPGGSGINLIKHMKREEMTRNIPVVMLTARGEEEDKVRGLEVGADDYITKPFSPKELVARLKAVIRRVTPTALEDVIDVQGLKLDPVSHRVTANDQPLDMGPTEFKMLHFFMTHQERVYSREQLLNNVWGTNVYVEDRTVDVHIRRLRKALEDAGHDKLIQTVRGAGYRFSTKA



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9966 - -



  Protein sequence of regulator: 230 a.a.    .

>REG0369 NZ_KQ410503:c202495-201806 [Vibrio cholerae V52]
MSRRILVVEDEAPIREMLCFVLEQKGYQAVEAEDYDSAMSKLAEPFPDLVLLDWMLPGGSGINLIKHMKREEMTRNIPVV
MLTARGEEEDKVRGLEVGADDYITKPFSPKELVARLKAVIRRVTPTALEDVIDVQGLKLDPVSHRVTANDQPLDMGPTEF
KMLHFFMTHQERVYSREQLLNNVWGTNVYVEDRTVDVHIRRLRKALEDAGHDKLIQTVRGAGYRFSTKA*

  Nucleotide sequence of regulator: 690 bp    .

>REG0369 NZ_KQ410503:c202495-201806 [Vibrio cholerae V52]
ATGTCTAGAAGGATTCTGGTTGTTGAAGACGAAGCACCGATTCGTGAAATGTTGTGTTTCGTGCTTGAACAAAAGGGCTA
TCAGGCGGTTGAGGCTGAAGATTATGATTCGGCGATGAGTAAGCTGGCTGAGCCTTTTCCTGATCTCGTCCTGCTTGACT
GGATGTTGCCTGGTGGTAGTGGCATCAACCTCATCAAGCATATGAAGCGCGAAGAGATGACGCGCAACATTCCTGTTGTG
ATGCTCACCGCCCGTGGTGAAGAAGAAGATAAAGTTCGCGGCTTAGAAGTGGGCGCGGATGATTACATTACCAAACCGTT
TTCACCTAAAGAGTTGGTTGCCCGTTTAAAAGCGGTGATCCGCCGTGTCACTCCGACGGCGTTGGAGGATGTGATTGATG
TTCAAGGTTTGAAGTTAGATCCGGTCTCACACCGTGTGACCGCTAACGATCAGCCGTTGGATATGGGACCGACTGAGTTC
AAGATGTTACACTTCTTCATGACACACCAAGAGCGTGTGTATAGCCGCGAGCAGCTACTCAATAATGTTTGGGGCACCAA
CGTGTATGTGGAAGATCGCACGGTAGACGTCCACATTCGTCGTCTACGTAAAGCCTTAGAAGACGCTGGACATGATAAGC
TGATCCAGACGGTGCGCGGCGCGGGGTATCGTTTTTCAACCAAAGCCTAA