Detailed information of regulator


Summary

Regulator ID REG0364 experimental
Regulator type protein
Regulatory pathway (from literatures) Transcription regulator
KEGG pathway (determined by BlastKOALA) Biofilm formation - Vibrio cholerae (map05111); Biofilm formation - Escherichia coli (map02026)
Related T6SS T6SS00791 experimental (Type i4b)
Strain Edwardsiella tarda PPD130/91
Replicon chromosome
Sequence Protein sequence (329 a.a.); Nucleotide sequence (987 bp)
Description The steady-state protein level of EvpQ increased slightly in WT or Δfur strain, meanwhile it increased starkly in ΔrpoS strain and reached maximum at 24 hps. Both EvpQ and EseG are negatively controlled by RpoS, and intracellular EvpQ increases while EseG decreases with its growth.
Reference

External database links

Locus tag (Gene) Y113_RS11250 (RpoS)
Coordinates (Strand) 9122..10108 (-)
NCBI ID 502612732
RefSeq NZ_JACQ01000026
Uniprot ID D0ZDS7_EDWTE, C3U1E8_EDWTA, A0A0H3DT83_EDWTF
KEGG ID etr:ETAE_2873, etd:ETAF_2609
KEGG pathway (determined by BlastKOALA) map05111; map02026
PDB ID -

  Target
Target Regulation (↓/↑) Target sequence
EvpQ transcription and protein level -

Pfam domain hit(s) of regulator

Domain Pfam ID E-value Aligned region
Sigma70_r3 PF04539.18 1.3e-20 173..247
Sigma70_r2 PF04542.16 8.9e-20 93..162
Sigma70_r4 PF04545.18 2.6e-15 261..314
Sigma70_r1_2 PF00140.22 1.1e-11 55..88

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-328 MSHTTLKVNELHDEVELEDGVEDGFDEKALVEESMENDITDDELLSQSVSQRVLDATQLYLGEIGYAPLLTAEEEVFFARRALRGDEASRKRMIESNLRLVVKISRRYSNRGLALLDLIEEGNLGLIRAVEKFDPERGFRFSTYATWWIRQTIERAIMNQTRTIRLPIHIVKELNVYLRTARELSHKLDHEPSAEEIAERLEKPVHDVSRMLRLNERITSVDTPLGGDSEKALLDILTDENESGPEDCTQNDDMKQSIVKWLFELNAKQREVLARRFGLLGYEAATLEDVGREIGLTRERVRQIQVEGLRRLREILQMQGLSIEALFR



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9948 - -



  Protein sequence of regulator: 329 a.a.    .

>REG0364 NZ_JACQ01000026:c10108-9122 [Edwardsiella tarda PPD130/91]
MSHTTLKVNELHDEVELEDGVEDGFDEKALVEESMENDITDDELLSQSVSQRVLDATQLYLGEIGYAPLLTAEEEVFFAR
RALRGDEASRKRMIESNLRLVVKISRRYSNRGLALLDLIEEGNLGLIRAVEKFDPERGFRFSTYATWWIRQTIERAIMNQ
TRTIRLPIHIVKELNVYLRTARELSHKLDHEPSAEEIAERLEKPVHDVSRMLRLNERITSVDTPLGGDSEKALLDILTDE
NESGPEDCTQNDDMKQSIVKWLFELNAKQREVLARRFGLLGYEAATLEDVGREIGLTRERVRQIQVEGLRRLREILQMQG
LSIEALFR*

  Nucleotide sequence of regulator: 987 bp    .

>REG0364 NZ_JACQ01000026:c10108-9122 [Edwardsiella tarda PPD130/91]
ATGAGTCATACTACGCTGAAAGTTAACGAATTACATGATGAAGTCGAGTTGGAGGATGGCGTTGAGGACGGTTTTGACGA
GAAGGCCCTCGTCGAAGAGTCCATGGAAAATGACATTACCGATGATGAATTGCTGTCTCAGTCTGTTTCACAGCGCGTTT
TGGACGCCACGCAGCTCTATCTTGGCGAAATCGGCTATGCGCCGCTGCTGACGGCAGAGGAAGAGGTTTTCTTCGCTCGC
CGCGCTCTGCGCGGGGATGAGGCATCGCGTAAGCGGATGATCGAAAGCAACCTGCGGCTGGTGGTGAAGATCTCCCGTCG
CTACAGCAACCGCGGCCTGGCGCTGCTGGATCTGATCGAAGAGGGTAACCTGGGTCTGATCCGCGCGGTCGAGAAGTTTG
ACCCGGAGCGCGGCTTCCGCTTTTCGACCTACGCCACCTGGTGGATCCGTCAGACCATTGAACGGGCCATCATGAACCAG
ACTCGCACCATTCGCCTGCCTATCCATATCGTTAAAGAGCTTAACGTCTATCTGCGTACCGCCCGCGAACTCTCTCATAA
GCTGGACCATGAGCCGAGCGCGGAGGAGATCGCCGAGCGGCTGGAGAAGCCGGTGCATGACGTCAGCCGCATGCTGCGCC
TTAACGAGCGGATCACCTCGGTGGATACCCCGCTGGGCGGTGATTCGGAGAAGGCGCTGCTGGATATTCTGACCGATGAG
AACGAAAGCGGGCCGGAGGATTGCACCCAGAACGACGACATGAAGCAGAGCATCGTCAAGTGGCTGTTTGAGCTGAACGC
CAAGCAGCGCGAGGTGCTGGCGCGCCGCTTTGGCCTGCTGGGCTATGAGGCCGCCACGCTGGAGGACGTCGGGCGAGAGA
TTGGCCTGACCCGTGAGCGGGTGCGTCAAATTCAGGTTGAAGGGCTGCGGCGCCTGCGTGAGATCCTGCAGATGCAGGGG
CTGAGTATCGAAGCCCTGTTCCGCTGA