Detailed information of regulator


Summary

Regulator ID REG0362 experimental
Regulator type protein
Regulatory pathway (from literatures) TCS-RR
KEGG pathway (determined by BlastKOALA) Two-component system (map02020); Biofilm formation - Escherichia coli (map02026)
Related T6SS T6SS01034 experimental (Type i1)
Strain Escherichia coli PCN033
Replicon chromosome
Sequence Protein sequence (217 a.a.); Nucleotide sequence (651 bp)
Description qRT-PCR showed all genes (tssE, PXO_RS07340; tssD, PXO_RS07330; tssL, PXO_RS07400; vgrG, PXO_RS07300 & PXO_RS17555; tssH, PXO_RS07355) showed reduced expression in the RR35 mutant strain compared to that in PXO99A.
Reference

External database links

Locus tag (Gene) PPECC33_RS11945 (rcsB)
Coordinates (Strand) 2429320..2429970 (+)
NCBI ID 446984661
RefSeq NZ_CP006632
Uniprot ID A0A0E0Y073_ECO1C, K4Y299_ECOLX, S1PG98_ECOLX, S1F473_ECOLX, L3Q2N3_ECOLX, L4J632_ECOLX, A0A0F6RFA2_CITAM, U9YD36_ECOLX, U9YL55_ECOLX, V0SF26_ECOLX, U9Z989_ECOLX, V0UR83_ECOLX, V0XRY5_ECOLX, V0ZFU1_ECOLX, U9ZZ96_ECOLX, A0A0E2LJT6_ECOU3, A0A080IUV1_ECOLX, A0A0A0FDX6_ECOLX, RCSB_ECOL6, A0A2K9P6I0_9ENTR, D3H0Q7_ECO44, A8ADZ6_CITK8, Q32I20_SHIDS, E3PDR9_ECOH1, A7ZP39_ECO24, A0A2S4S3B2_CITAM, A0A0H2Z1B9_ECOK1, B1LKW4_ECOSM, A0A0H3PXI1_ECO5C, A0A078LB51_CITKO, D6IC33_ECOLX, D6JCB8_ECOLX, A0A0M3F799_ENTCL, RCSB_ECOLX, E0IY85_ECOLW, A0A181WN86_KLEOX, B7UFN1_ECO27, B7MFD0_ECO45, B7LAP1_ECO55, B7N5H9_ECOLU, A0A0H3MS51_ECO7I, B7MXP8_ECO81, A0A1Q8M5C2_SHIBO, A0A1S9K1N2_SHIDY, RCSB_SHIFL, A0A0I2FRE2_SHISO, A0A0K9TA32_ECOLX, A0A1X3LLE3_ECOLX, A0A1X3LZJ9_ECOLX, E9XL29_ECOLX, E6BKG3_ECOLX, E1IJN9_ECOLX, E1JDV8_ECOLX, D8E7Q5_ECOLX, A0A0H3EL51_ECO8N, A0A0E1M3W6_ECOLX, D8A5G4_ECOMS, D7XL34_ECOLX, D7Y4X8_ECOM1, E9T9C7_ECOLX, I4T573_ECOLX, RCSB_ECOLI, RCSB_ECO57, J9JEG3_ECO57, I2UP38_ECOLX, I2WNX7_ECOLX
KEGG ID elw:ECW_m2419, ecq:ECED1_2683, ect:ECIAI39_2355, cko:CKO_00553, ecv:APECO1_4342, cama:F384_11900, sfl:SF2301, ecg:E2348C_2362, sdy:SDY_0857, ecs:ECs3106, sfx:S2432, eum:ECUMN_2554, ecw:EcE24377A_2517, ecj:JW2205, ecz:ECS88_2366, eck:EC55989_2472, eco:b2217, ecc:c2760, ecm:EcSMS35_2366, eln:NRG857_11250, elh:ETEC_2351, elo:EC042_2458, caf:AL524_10995, esl:O3K_08360, ece:Z3476
KEGG pathway (determined by BlastKOALA) map02020; map02026
PDB ID 5VXN, 5W43, 5I4C

  Target
Target Regulation (↓/↑) Target sequence
T6SS transcription -

Pfam domain hit(s) of regulator

Domain Pfam ID E-value Aligned region
Response_reg PF00072.26 1.4e-24 6..120
GerE PF00196.21 3.4e-12 151..201

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-216 MNNMNVIIADDHPIVLFGIRKSLEQIEWVNVVGEFEDSTALINNLPKLDAHVLITDLSMPGDKYGDGITLIKYIKRHFPSLSIIVLTMNNNPAILSAVLDLDIEGIVLKQGAPTDLPKALAALQKGKKFTPESVSRLLEKISAGGYGDKRLSPKESEVLRLFAEGFLVTEIAKKLNRSIKTISSQKKSAMMKLGVENDIALLNYLSSVTLSPADKD



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9975 - -



  Protein sequence of regulator: 217 a.a.    .

>REG0362 NZ_CP006632:2429320-2429970 [Escherichia coli PCN033]
MNNMNVIIADDHPIVLFGIRKSLEQIEWVNVVGEFEDSTALINNLPKLDAHVLITDLSMPGDKYGDGITLIKYIKRHFPS
LSIIVLTMNNNPAILSAVLDLDIEGIVLKQGAPTDLPKALAALQKGKKFTPESVSRLLEKISAGGYGDKRLSPKESEVLR
LFAEGFLVTEIAKKLNRSIKTISSQKKSAMMKLGVENDIALLNYLSSVTLSPADKD*

  Nucleotide sequence of regulator: 651 bp    .

>REG0362 NZ_CP006632:2429320-2429970 [Escherichia coli PCN033]
ATGAACAATATGAACGTAATTATTGCCGATGACCATCCGATAGTCTTGTTCGGTATTCGCAAATCACTTGAGCAAATTGA
GTGGGTGAATGTTGTCGGCGAATTTGAAGACTCTACAGCACTGATCAACAACCTGCCGAAACTGGATGCGCATGTGTTGA
TTACCGATCTCTCCATGCCTGGCGATAAGTACGGCGATGGCATTACCTTAATCAAGTACATCAAGCGCCATTTCCCAAGC
CTGTCGATCATTGTTCTGACTATGAACAACAACCCGGCGATTCTTAGTGCGGTATTGGATCTGGATATCGAAGGGATCGT
GCTGAAACAAGGTGCACCGACCGATCTGCCGAAAGCTCTCGCCGCGCTGCAGAAAGGGAAGAAATTTACCCCGGAAAGCG
TTTCTCGCCTGTTGGAAAAAATCAGTGCTGGTGGTTACGGTGACAAGCGTCTCTCGCCAAAAGAGAGTGAAGTTCTGCGC
CTGTTTGCTGAAGGCTTCCTGGTGACCGAGATCGCTAAAAAGCTGAACCGCAGTATCAAAACCATCAGTAGCCAGAAGAA
ATCTGCGATGATGAAGCTGGGTGTCGAGAACGATATTGCTCTGCTGAATTATCTCTCTTCTGTGACCTTAAGTCCGGCAG
ATAAAGACTAA