Detailed information of regulator


Summary

Regulator ID REG0358 experimental
Regulator type protein
Regulatory pathway (from literatures) TCS-RR
KEGG pathway (determined by BlastKOALA) Two-component system (map02020)
Related T6SS T6SS01034 experimental (Type i1)
Strain Escherichia coli PCN033
Replicon chromosome
Sequence Protein sequence (241 a.a.); Nucleotide sequence (723 bp)
Description EMSA assays indicated that phosphorylated BaeR (BaeR-P) directly bound to promoter DNA region 1 of PCN033. A 294 bp fragment in the T6SS gene cluster was used for DNase I foot-printing assay. BaeR induced the expression of T6SS under zinc attack, which in turn directly contributed to bacteria zinc tolerance.
Reference

External database links

Locus tag (Gene) PPECC33_RS11185 (BaeR)
Coordinates (Strand) 2272864..2273586 (+)
NCBI ID 446060022
RefSeq NZ_CP006632
Uniprot ID K4XEW4_ECOLX, S1F3J2_ECOLX, V0SLQ3_ECOLX, U9ZTE1_ECOLX, V0VKC8_ECOLX, V0Z0P5_ECOLX, V0A455_ECOLX, A0A0E2L5A3_ECOU3, BAER_ECOL6, D3GZE3_ECO44, Q32EI3_SHIDS, E3PCM7_ECOH1, A0A0E1SUN8_ECOLX, Q1R9Z2_ECOUT, A0A0H2Z098_ECOK1, B1LNW2_ECOSM, A0A140N8R1_ECOBD, D6I9E7_ECOLX, D6JBX9_ECOLX, A0A181WNA6_KLEOX, B7UTB7_ECO27, B7ME91_ECO45, B7LV43_ESCF3, B7NCB5_ECOLU, B7MWZ2_ECO81, A0A1Q8M6V6_SHIBO, A0A2S8E2K2_SHIDY, A0A0I1VB19_SHISO, A0A1X3I5P4_ECOLX, F4T1E9_ECOLX, A0A1X3LZA0_ECOLX, A0A1X3IZT8_ECOLX, A0A0H3ELS6_ECO8N, A0A0E1M0U4_ECOLX, I4T4P8_ECOLX, BAER_ECOLI, I2X2N2_ECOLX, A0A192C904_ECOLX
KEGG ID ecm:EcSMS35_0981, ecv:APECO1_1169, ecz:ECS88_2178, ebd:ECBD_1574, sdy:SDY_2186, eln:NRG857_10565, elo:EC042_2318, eum:ECUMN_2417, ecc:c2605, ecg:E2348C_2222, ecj:JW2064, efe:EFER_2166, elh:ETEC_2222, ecq:ECED1_2425, eci:UTI89_C2354, eco:b2079
KEGG pathway (determined by BlastKOALA) map02020
PDB ID 4B09

  Target
Target Regulation (↓/↑) Target sequence
T6SS promotor cattACTGCACCGAAATTGTGCTTGTTAACGGAAACTGCCTGACGTTCAT

Pfam domain hit(s) of regulator

Domain Pfam ID E-value Aligned region
Response_reg PF00072.26 1.3e-24 13..121
Trans_reg_C PF00486.30 3.8e-23 157..231

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-240 MTELPIDENTPRILIVEDEPKLGQLLIDYLRAASYAPTLISHGDQVLPYVRQTPPDLILLDLMLPGTDGLTLCREIRRFSDIPIVMVTAKIEEIDRLLGLEIGADDYICKPYSPREVVARVKTILRRCKPQRELQQQDAESPLIIDEGRFQASWRGKMLDLTPAEFRLLKTLSHEPGKVFSREQLLNHLYDDYRVVTDRTIDSHIKNLRRKLESLDAEQSFIRAVYGVGYRWEADACRIV



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9972 - -



  Protein sequence of regulator: 241 a.a.    .

>REG0358 NZ_CP006632:2272864-2273586 [Escherichia coli PCN033]
MTELPIDENTPRILIVEDEPKLGQLLIDYLRAASYAPTLISHGDQVLPYVRQTPPDLILLDLMLPGTDGLTLCREIRRFS
DIPIVMVTAKIEEIDRLLGLEIGADDYICKPYSPREVVARVKTILRRCKPQRELQQQDAESPLIIDEGRFQASWRGKMLD
LTPAEFRLLKTLSHEPGKVFSREQLLNHLYDDYRVVTDRTIDSHIKNLRRKLESLDAEQSFIRAVYGVGYRWEADACRIV
*

  Nucleotide sequence of regulator: 723 bp    .

>REG0358 NZ_CP006632:2272864-2273586 [Escherichia coli PCN033]
ATGACCGAGTTACCAATCGACGAAAACACACCGCGTATTTTGATCGTGGAAGATGAACCGAAGCTGGGGCAGTTACTCAT
TGATTATCTGCGTGCTGCGAGCTATGCGCCGACGCTTATCAGCCACGGCGATCAGGTACTGCCGTATGTGCGCCAGACAC
CACCGGATCTGATCCTGTTGGATCTGATGCTCCCTGGCACCGATGGCTTGACGCTGTGCCGGGAAATTCGTCGTTTTTCT
GACATTCCGATCGTGATGGTGACAGCAAAAATCGAAGAGATCGACCGCCTGCTGGGGCTGGAAATTGGCGCTGATGACTA
CATCTGCAAACCGTACAGCCCACGGGAAGTGGTAGCGCGCGTCAAAACCATTTTGCGCCGTTGCAAACCCCAGCGTGAGT
TGCAGCAACAGGATGCTGAAAGCCCGTTGATTATCGACGAAGGTCGTTTTCAGGCTTCCTGGCGCGGAAAAATGCTTGAC
CTGACGCCTGCGGAATTTCGTCTGCTGAAAACGCTCTCTCATGAACCAGGAAAAGTGTTCTCCCGCGAACAATTGCTCAA
TCATCTTTATGACGACTACCGCGTAGTAACCGACCGCACTATCGACAGCCACATTAAAAACCTGCGTCGCAAGCTGGAAT
CTCTCGACGCCGAACAGTCCTTTATCCGTGCCGTTTACGGCGTCGGTTACCGCTGGGAAGCCGACGCCTGCCGCATCGTT
TAA