Detailed information of regulator


Summary

Regulator ID REG0346 experimental
Regulator type protein
Regulatory pathway (from literatures) Global regulator
KEGG pathway (determined by BlastKOALA) Biofilm formation - Vibrio cholerae (map05111); Biofilm formation - Escherichia coli (map02026)
Related T6SS T6SS01214 experimental (Type Unknown)
Strain Klebsiella pneumoniae strain Kp52.145
Replicon chromosome
Sequence Protein sequence (331 a.a.); Nucleotide sequence (993 bp)
Description The expression of tssB::lucFF was significantly higher in the h-ns, mgrB and rcsB mutant backgrounds than in the wild-type one and E. coli was not killed when co-incubated with rpoN, rpoS, hfq, fur and pmrAB mutants.
Reference

External database links

Locus tag (Gene) BN49_RS06445 (rpoS)
Coordinates (Strand) 1060243..1061235 (+)
NCBI ID 489004494
RefSeq NZ_FO834906
Uniprot ID A0A0H3GXG2_KLEPH, V0AQ18_KLEPN, A0A1C1F2P3_9ENTR, A0A1F2M191_9ENTR, A0A223U6X8_9ENTR, A0A2S0VHY9_9ENTR, A0A087FV69_KLEVA, A6TD33_KLEP7, B5XV40_KLEP3, A0A2W0N178_KLEPN, R4YDW0_KLEPR
KEGG ID kqu:AVR78_25315, kpw:KPNIH30_21000, kpm:KPHS_41780, kpg:KPNIH32_21860, kpe:KPK_1020, kpt:VK055_4413, kpn:KPN_03103, ebu:CUC76_20745, kpr:KPR_4100, kpv:KPNIH29_20980, kpk:A593_05700, kpy:KPNIH31_20215, kvq:SP68_09700, kvd:KR75_03145
KEGG pathway (determined by BlastKOALA) map05111; map02026
PDB ID -

  Target
Target Regulation (↓/↑) Target sequence
TssB transcription -

Pfam domain hit(s) of regulator

Domain Pfam ID E-value Aligned region
Sigma70_r2 PF04542.16 4.2e-21 94..163
Sigma70_r3 PF04539.18 6e-21 174..248
Sigma70_r4 PF04545.18 2.6e-15 262..315
Sigma70_r1_2 PF00140.22 3.2e-11 56..88

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-330 MSQNTLKVHDLNEDAEFDENGIEVFDEKALVEEEPSDSDLAEEELLSQGATQRVLDATQLYLGEIGYSPLLTAEEEVYFARRALRGDVASRRRMIESNLRLVVKIARRYSNRGLALLDLIEEGNLGLIRAVEKFDPERGFRFSTYATWWIRQTIERAIMNQTRTIRLPIHIVKELNVYLRTARELSHKLDHEPSAEEIAEQLDKPVDDVSRMLRLNERITSVDTPLGGDSEKALLDILADEKENGPEDTTQDDDMKQSIVKWLFELNAKQREVLARRFGLLGYEAATLEDVGREIGLTRERVRQIQVEGLRRLREILQGQGLNIEALFRE



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9932 - -



  Protein sequence of regulator: 331 a.a.    .

>REG0346 NZ_FO834906:1060243-1061235 [Klebsiella pneumoniae]
MSQNTLKVHDLNEDAEFDENGIEVFDEKALVEEEPSDSDLAEEELLSQGATQRVLDATQLYLGEIGYSPLLTAEEEVYFA
RRALRGDVASRRRMIESNLRLVVKIARRYSNRGLALLDLIEEGNLGLIRAVEKFDPERGFRFSTYATWWIRQTIERAIMN
QTRTIRLPIHIVKELNVYLRTARELSHKLDHEPSAEEIAEQLDKPVDDVSRMLRLNERITSVDTPLGGDSEKALLDILAD
EKENGPEDTTQDDDMKQSIVKWLFELNAKQREVLARRFGLLGYEAATLEDVGREIGLTRERVRQIQVEGLRRLREILQGQ
GLNIEALFRE*

  Nucleotide sequence of regulator: 993 bp    .

>REG0346 NZ_FO834906:1060243-1061235 [Klebsiella pneumoniae]
ATGAGTCAGAATACGCTGAAAGTTCATGATTTAAATGAAGACGCGGAATTTGATGAGAACGGAATTGAGGTTTTCGACGA
GAAAGCCTTAGTAGAAGAGGAACCCAGTGATAGCGATCTGGCTGAGGAAGAGCTGCTGTCGCAAGGCGCAACCCAGCGCG
TACTTGACGCCACTCAGCTTTATCTTGGAGAGATTGGTTATTCCCCACTGCTGACCGCGGAAGAGGAAGTCTATTTCGCG
CGTCGCGCACTGCGTGGTGATGTCGCTTCACGCCGTCGCATGATTGAAAGTAACTTGCGTCTGGTGGTGAAGATTGCCCG
TCGTTACAGCAATCGTGGTCTGGCGCTGCTGGATCTGATTGAAGAAGGTAACCTCGGCCTGATCCGCGCCGTTGAGAAGT
TTGACCCGGAACGTGGGTTCCGTTTTTCGACCTACGCGACCTGGTGGATCCGCCAGACTATTGAACGGGCGATCATGAAC
CAAACCCGTACGATCCGTTTGCCGATCCATATTGTTAAAGAGCTGAACGTCTATCTGCGTACCGCGCGCGAGTTGTCCCA
TAAGCTGGACCACGAGCCTAGCGCGGAAGAGATCGCCGAACAGCTGGACAAACCGGTCGATGACGTCAGCCGTATGCTGC
GTCTGAACGAGCGCATCACCTCCGTGGATACTCCGCTGGGTGGCGATTCAGAAAAAGCGCTGCTGGATATTCTGGCCGAT
GAGAAAGAGAACGGCCCGGAAGACACCACGCAGGACGATGATATGAAGCAAAGTATCGTCAAATGGCTGTTCGAACTGAA
CGCCAAGCAGCGTGAAGTTCTGGCACGTCGTTTTGGTCTGCTGGGTTATGAAGCTGCCACGCTGGAGGATGTGGGCCGTG
AAATTGGCCTGACCCGCGAACGCGTGCGGCAGATCCAGGTGGAAGGTCTGCGTCGCCTGCGGGAAATTCTGCAGGGACAG
GGGCTGAATATCGAAGCGCTCTTCCGCGAATAA