Detailed information of regulator


Summary

Regulator ID REG0345 experimental
Regulator type protein
Regulatory pathway (from literatures) Global regulator
KEGG pathway (determined by BlastKOALA) Two-component system (map02020); Biofilm formation - Vibrio cholerae (map05111); Flagellar assembly (map02040)
Related T6SS T6SS01214 experimental (Type Unknown)
Strain Klebsiella pneumoniae strain Kp52.145
Replicon chromosome
Sequence Protein sequence (478 a.a.); Nucleotide sequence (1434 bp)
Description The expression of tssB::lucFF was significantly higher in the h-ns, mgrB and rcsB mutant backgrounds than in the wild-type one and E. coli was not killed when co-incubated with rpoN, rpoS, hfq, fur and pmrAB mutants.
Reference

External database links

Locus tag (Gene) BN49_RS03755 (rpoN)
Coordinates (Strand) 533564..534997 (-)
NCBI ID 489007850
RefSeq NZ_FO834906
Uniprot ID A0A0H3H3L1_KLEPH, V0AX08_KLEPN, A0A0E1C7X2_KLEPN, W8UTV3_KLEPN, A0A0N9UTC1_KLEPN, A0A1Y0PV06_KLEPN, R4YEY9_KLEPR
KEGG ID kpw:KPNIH30_23930, kpnk:BN49_0508, kpnu:LI86_02660, kpm:KPHS_47510, kpb:FH42_14430, kpr:KPR_4804, kpv:KPNIH29_23605, kpx:PMK1_01120, kpa:KPNJ1_00539, kpg:KPNIH32_24810, kpne:KU54_002655, kps:KPNJ2_00577, kpy:KPNIH31_23045
KEGG pathway (determined by BlastKOALA) map02020; map05111; map02040
PDB ID 5NWT, 5BYH

  Target
Target Regulation (↓/↑) Target sequence
TssB transcription -

Pfam domain hit(s) of regulator

Domain Pfam ID E-value Aligned region
Sigma54_DBD PF04552.15 2.1e-70 317..475
Sigma54_CBD PF04963.15 3e-61 116..303
Sigma54_AID PF00309.22 1e-15 5..48

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-477 MKQGLQLRLSQQLAMTPQLQQAIRLLQLSTLELQQELQQALESNPLLEQTDLHDEVEAKEVEDRESLDTVDALEQKEMPDELPLDASWDEIYTAGTPSGNGVDYQDDELPVYQGETTQTLQDYLMWQVELTPFTDTDRAIATSIVDAVDDTGYLTIQIEDIVDSIGDDEIGLEEVEAVLKRIQRFDPVGVAAKDLRDCLLIQLSQFAKETPWLEEARLIISDHLDLLANHDFRTLMRVTRLKEEVLKEAVNLIQSLDPRPGQSIQTSEPEYVIPDVLVRKVSGRWTVELNADSIPRLKINQQYAAMGNSARNDADGQFIRSNLQEARWLIKSLESRNDTLLRVSRCIVEQQQAFFEQGEEYMKPMVLADIAQAVEMHESTISRVTTQKYLHSPRGIFELKYFFSSHVNTEGGGEASSTAIRALVKKLIAAENPAKPLSDSKLTSMLSEQGIMVARRTVAKYRESLSIPPSNQRKQLV



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9792 - -



  Protein sequence of regulator: 478 a.a.    .

>REG0345 NZ_FO834906:c534997-533564 [Klebsiella pneumoniae]
MKQGLQLRLSQQLAMTPQLQQAIRLLQLSTLELQQELQQALESNPLLEQTDLHDEVEAKEVEDRESLDTVDALEQKEMPD
ELPLDASWDEIYTAGTPSGNGVDYQDDELPVYQGETTQTLQDYLMWQVELTPFTDTDRAIATSIVDAVDDTGYLTIQIED
IVDSIGDDEIGLEEVEAVLKRIQRFDPVGVAAKDLRDCLLIQLSQFAKETPWLEEARLIISDHLDLLANHDFRTLMRVTR
LKEEVLKEAVNLIQSLDPRPGQSIQTSEPEYVIPDVLVRKVSGRWTVELNADSIPRLKINQQYAAMGNSARNDADGQFIR
SNLQEARWLIKSLESRNDTLLRVSRCIVEQQQAFFEQGEEYMKPMVLADIAQAVEMHESTISRVTTQKYLHSPRGIFELK
YFFSSHVNTEGGGEASSTAIRALVKKLIAAENPAKPLSDSKLTSMLSEQGIMVARRTVAKYRESLSIPPSNQRKQLV*

  Nucleotide sequence of regulator: 1434 bp    .

>REG0345 NZ_FO834906:c534997-533564 [Klebsiella pneumoniae]
ATGAAGCAAGGTTTGCAATTAAGGCTTAGCCAACAGCTTGCCATGACGCCGCAGCTGCAGCAGGCGATTCGTTTGCTGCA
GTTGTCCACGTTAGAACTCCAGCAAGAACTCCAGCAAGCGCTGGAAAGTAACCCGTTGCTTGAGCAAACCGATCTTCACG
ACGAGGTAGAGGCAAAAGAGGTGGAGGACCGCGAGTCCCTCGATACCGTCGATGCGCTTGAGCAAAAAGAGATGCCCGAC
GAACTGCCTCTCGATGCCAGCTGGGATGAAATCTATACCGCTGGCACGCCGTCGGGTAACGGCGTCGACTATCAGGACGA
CGAGCTTCCCGTCTATCAAGGCGAGACCACCCAGACGCTGCAGGACTATCTGATGTGGCAGGTTGAGCTGACGCCTTTCA
CCGACACCGACCGCGCTATTGCCACCTCTATCGTCGACGCCGTCGACGATACGGGCTACCTCACGATTCAGATTGAAGAT
ATTGTCGACAGCATCGGCGATGACGAGATCGGCCTGGAGGAGGTGGAAGCGGTCCTCAAGCGAATCCAGCGTTTTGATCC
GGTTGGCGTCGCAGCGAAAGATCTGCGCGACTGCCTGCTGATCCAGCTGTCGCAATTTGCTAAAGAGACGCCGTGGCTGG
AAGAGGCGCGGCTGATTATCAGCGACCATCTTGATCTGCTGGCCAACCATGATTTCCGCACTCTAATGCGAGTCACCCGC
CTGAAAGAAGAGGTGCTTAAAGAGGCGGTCAACCTGATCCAGTCCCTGGATCCTCGCCCTGGCCAGTCCATTCAGACCAG
CGAACCGGAATATGTCATCCCGGATGTGCTGGTGCGCAAGGTGAGCGGCCGCTGGACCGTCGAGCTCAACGCCGACAGCA
TTCCACGGTTGAAAATAAATCAGCAGTATGCGGCAATGGGCAACAGCGCCCGCAATGACGCCGACGGCCAGTTCATTCGC
AGCAATCTGCAGGAAGCCCGCTGGCTGATTAAAAGTCTGGAAAGCCGCAACGATACCCTGCTGCGCGTCAGCCGCTGCAT
CGTAGAGCAGCAGCAGGCTTTTTTCGAACAGGGTGAAGAGTATATGAAGCCGATGGTGCTGGCCGATATCGCCCAGGCCG
TCGAGATGCATGAATCGACGATTTCCCGTGTCACCACGCAAAAATATCTGCACAGTCCGCGCGGTATTTTTGAACTGAAG
TATTTCTTCTCCAGCCATGTGAATACCGAAGGCGGAGGCGAAGCCTCGTCGACGGCGATTCGCGCGCTGGTGAAGAAGCT
CATCGCCGCGGAAAACCCCGCGAAACCGTTGAGCGACAGTAAGCTCACCTCCATGCTGTCCGAGCAGGGTATTATGGTGG
CGCGCCGCACTGTCGCGAAGTACAGAGAGTCTTTATCCATCCCGCCGTCAAACCAGCGTAAACAACTGGTCTGA