Detailed information of regulator


Summary

Regulator ID REG0342 experimental
Regulator type protein
Regulatory pathway (from literatures) Global regulator
KEGG pathway (determined by BlastKOALA) -
Related T6SS T6SS01214 experimental (Type Unknown)
Strain Klebsiella pneumoniae strain Kp52.145
Replicon chromosome
Sequence Protein sequence (136 a.a.); Nucleotide sequence (408 bp)
Description The expression of tssB::lucFF was significantly higher in the h-ns, mgrB and rcsB mutant backgrounds than in the wild-type one and co-incubation of the h-ns, mgrB and rcsB mutants with E. coli in LB resulted in a significant reduction in E. coli survival.
Reference

External database links

Locus tag (Gene) BN49_RS18480 (h-ns)
Coordinates (Strand) 3427636..3428043 (+)
NCBI ID 488999426
RefSeq NZ_FO834906
Uniprot ID A0A0H3GUZ5_KLEPH, J2X6T6_KLEPN, V0AJS6_KLEPN, A0A0E1CD91_KLEPN, W8UIU7_KLEPN, A0A1C1F5G4_9ENTR, A0A1F2M8X2_9ENTR, A0A223UAK6_9ENTR, A0A2S0VKE8_9ENTR, A0A087FPY4_KLEVA, A6TAK8_KLEP7, B5XQ96_KLEP3, A0A1Y0PYQ6_KLEPN, R4YAU9_KLEPR
KEGG ID kqu:AVR78_20130, kpe:KPK_2107, kpv:KPNIH29_15970, kpm:KPHS_31980, kpw:KPNIH30_16255, kps:KPNJ2_02205, kpr:KPR_3120, kpy:KPNIH31_15440, kpn:KPN_02201, kvd:KR75_24365, ebu:CUC76_25475, kpg:KPNIH32_16150, kpk:A593_00580, kvq:SP68_04640, kpa:KPNJ1_02245
KEGG pathway (determined by BlastKOALA) -
PDB ID -

  Target
Target Regulation (↓/↑) Target sequence
TssB transcription -

Pfam domain hit(s) of regulator

Domain Pfam ID E-value Aligned region
Histone_HNS PF00816.23 1.2e-18 33..127

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-135 MSEALKILNNIRTLRAQARECTLETLEEMLEKLEVVVNERREEENAAAAEIEERTRKLQQYREMLIADGIDPNELLSTMAAVKAGTKTKRAARPAKYSYVDENGETKTWTGQGRTPAVIKKAMDEQGKSLDDFLI



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9966 - -



  Protein sequence of regulator: 136 a.a.    .

>REG0342 NZ_FO834906:3427636-3428043 [Klebsiella pneumoniae]
MSEALKILNNIRTLRAQARECTLETLEEMLEKLEVVVNERREEENAAAAEIEERTRKLQQYREMLIADGIDPNELLSTMA
AVKAGTKTKRAARPAKYSYVDENGETKTWTGQGRTPAVIKKAMDEQGKSLDDFLI*

  Nucleotide sequence of regulator: 408 bp    .

>REG0342 NZ_FO834906:3427636-3428043 [Klebsiella pneumoniae]
ATGAGCGAAGCACTTAAAATTTTGAACAACATCCGTACTCTTCGTGCGCAGGCAAGAGAATGCACCCTGGAAACGCTCGA
AGAAATGCTGGAAAAATTAGAAGTCGTCGTTAACGAGCGCCGTGAAGAAGAAAACGCTGCCGCGGCAGAAATTGAAGAGC
GTACGCGTAAGCTGCAGCAATACCGTGAAATGCTGATTGCTGACGGTATTGATCCGAATGAACTGCTGAGCACCATGGCT
GCCGTTAAAGCCGGTACCAAAACCAAGCGTGCTGCACGTCCGGCTAAATATAGCTATGTTGACGAAAACGGTGAAACCAA
AACCTGGACCGGTCAGGGCCGTACCCCGGCTGTGATCAAAAAAGCAATGGATGAGCAAGGTAAATCACTGGACGATTTCC
TGATCTAA