Detailed information of regulator


Summary

Regulator ID REG0340 experimental
Regulator type protein
Regulatory pathway (from literatures) TCS regulatory pathway
KEGG pathway (determined by BlastKOALA) -
Related T6SS T6SS01214 experimental (Type Unknown)
Strain Klebsiella pneumoniae strain Kp52.145
Replicon chromosome
Sequence Protein sequence (48 a.a.); Nucleotide sequence (144 bp)
Description The expression of tssB::lucFF was significantly higher in the h-ns, mgrB and rcsB mutant backgrounds than in the wild-type one and co-incubation of the h-ns, mgrB and rcsB mutants with E. coli in LB resulted in a significant reduction in E. coli survival.
Reference

External database links

Locus tag (Gene) BN49_RS29275 (mgrB)
Coordinates (Strand) 3583038..3583181 (-)
NCBI ID 489000713
RefSeq NZ_FO834906
Uniprot ID A0A0H3HIQ0_KLEOK, A0A1Q8YNF7_9ENTR, V0B1N8_KLEPN, A0A1C1F5A7_9ENTR, A0A1F2LXV1_9ENTR, A0A1D8JVR0_9ENTR, A0A2S0VK07_9ENTR, A0A264C0F7_KLEVA, MGRB_KLEP3, A0A0G3S8M8_KLEOX, A0A0E4AX29_KLEPN, A0A2W0U461_KLEPN, J6IIL4_9ENTR
KEGG ID kpk:A593_01320, ebu:CUC76_24835, kvd:KR75_25030, kom:HR38_22005, kpt:VK055_0108, kvq:SP68_05400, kox:KOX_23700, kll:BJF97_17875, koc:AB185_18145, kpe:KPK_1949
KEGG pathway (determined by BlastKOALA) -
PDB ID -

  Target
Target Regulation (↓/↑) Target sequence
phoPQ -

Pfam domain hit(s) of regulator

Domain Pfam ID E-value Aligned region
MgrB PF13998.8 1.4e-16 19..47

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Inside 1-6 VKKLRW
Transmembrane helix 7-24 VLLIVIIAGCLLLWTQML
Outside 25-47 NVMCDQDVQFFSGICTINKFIPW



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
LIPO(Sec/SPII) 0.5550 pos: 15-16. IAG-CL. VKKLRWVLLIVIIAG



  Protein sequence of regulator: 48 a.a.    .

>REG0340 NZ_FO834906:c3583181-3583038 [Klebsiella pneumoniae]
VKKLRWVLLIVIIAGCLLLWTQMLNVMCDQDVQFFSGICTINKFIPW*

  Nucleotide sequence of regulator: 144 bp    .

>REG0340 NZ_FO834906:c3583181-3583038 [Klebsiella pneumoniae]
GTGAAAAAATTACGGTGGGTTTTACTGATAGTCATCATAGCAGGCTGCCTGTTGCTGTGGACTCAGATGCTTAACGTAAT
GTGCGACCAGGATGTTCAGTTTTTCAGCGGCATTTGCACTATTAATAAATTTATTCCGTGGTAA