Detailed information of regulator


Summary

Regulator ID REG0338 experimental
Regulator type protein
Regulatory pathway (from literatures) TCS-RR
KEGG pathway (determined by BlastKOALA) Two-component system (map02020); Cationic antimicrobial peptide (CAMP) resistance (map01503)
Related T6SS T6SS01214 experimental (Type Unknown)
Strain Klebsiella pneumoniae strain Kp52.145
Replicon chromosome
Sequence Protein sequence (489 a.a.); Nucleotide sequence (1467 bp)
Description The expression of tssB::lucFF was significantly higher in the h-ns, mgrB and rcsB mutant backgrounds than in the wild-type one and E. coli was not killed when co-incubated with rpoN, rpoS, hfq, fur and pmrAB mutants.
Reference

External database links

Locus tag (Gene) BN49_RS12735 (phoQ)
Coordinates (Strand) 2324171..2325637 (-)
NCBI ID 490249900
RefSeq NZ_FO834906
Uniprot ID A0A0H3GLK4_KLEPH, J2DM97_KLEPN, V0A7W4_KLEPN, W8UX14_KLEPN, A6T7J7_KLEP7, W9BNY9_KLEPN, A0A232IWE5_KLEPN
KEGG ID kps:KPNJ2_03388, kpn:KPN_01135, kpx:PMK1_03475, kpt:VK055_1327, kpy:KPNIH31_09980, kpne:KU54_016110, kpv:KPNIH29_10075, kpm:KPHS_20120, kpb:FH42_01485, kpg:KPNIH32_10390, kpnk:BN49_2224
KEGG pathway (determined by BlastKOALA) map02020; map01503
PDB ID -

  Target
Target Regulation (↓/↑) Target sequence
TssB transcription -

Pfam domain hit(s) of regulator

Domain Pfam ID E-value Aligned region
PhoQ_Sensor PF08918.12 2e-88 10..189
HATPase_c PF02518.28 6.1e-13 376..475

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-19 MKGLLRHIFPLSLRVRFLL
Transmembrane helix 20-42 ATAGVVLVLSLAYGMVALVGYSV
Inside 43-193 SFDKTTFRLLRGESNLFYMLARWENGAIDVDIPENLNMESPTVTLIYDEQGKLLWAQRDVPWLAKRIQPEWLKRNGFHEIEADVDSSSMLLRNNHEIQEQLDAIREQGDDSEMTHSVAINLYPATSKMPQLSIVVVDTIPVELKRSYMVWS
Transmembrane helix 194-216 WFVYVLAANLLLVIPLLWVAAWW
Outside 217-488 SLRPIESLAKEVRELEEHHREKLNPNTTRELTRLVSNLNRLVRSERERYDKYRTTLTDLTHSLKTPLAVMQSTLRSLRGEKISVDEAEPVMLEQISRISQQIGYYLHRASMRSGGTLLSRELHPIAPLLDSLTSALNKVYQRKGVNISLDISPEITFVGEQNDFMEVMGNVLDNACKYCLEFVEVSVRQTTDSHLHILVEDDGPGIPQSQRRAVFDRGQRADTLRPGQGVGLSVAREIVEQYDGEIIAGESLLGGACMEVVFGRQQMEDKQS



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9767 - -



  Protein sequence of regulator: 489 a.a.    .

>REG0338 NZ_FO834906:c2325637-2324171 [Klebsiella pneumoniae]
MKGLLRHIFPLSLRVRFLLATAGVVLVLSLAYGMVALVGYSVSFDKTTFRLLRGESNLFYMLARWENGAIDVDIPENLNM
ESPTVTLIYDEQGKLLWAQRDVPWLAKRIQPEWLKRNGFHEIEADVDSSSMLLRNNHEIQEQLDAIREQGDDSEMTHSVA
INLYPATSKMPQLSIVVVDTIPVELKRSYMVWSWFVYVLAANLLLVIPLLWVAAWWSLRPIESLAKEVRELEEHHREKLN
PNTTRELTRLVSNLNRLVRSERERYDKYRTTLTDLTHSLKTPLAVMQSTLRSLRGEKISVDEAEPVMLEQISRISQQIGY
YLHRASMRSGGTLLSRELHPIAPLLDSLTSALNKVYQRKGVNISLDISPEITFVGEQNDFMEVMGNVLDNACKYCLEFVE
VSVRQTTDSHLHILVEDDGPGIPQSQRRAVFDRGQRADTLRPGQGVGLSVAREIVEQYDGEIIAGESLLGGACMEVVFGR
QQMEDKQS*

  Nucleotide sequence of regulator: 1467 bp    .

>REG0338 NZ_FO834906:c2325637-2324171 [Klebsiella pneumoniae]
ATGAAGGGACTGTTGCGGCATATCTTCCCGCTGTCATTACGGGTTCGCTTCCTGCTGGCGACCGCCGGGGTGGTGCTGGT
GCTCTCCCTGGCCTACGGCATGGTGGCCCTGGTGGGCTATAGCGTTAGCTTCGATAAAACCACCTTTCGCCTGCTGCGCG
GCGAGAGCAATCTCTTTTATATGCTGGCGAGATGGGAAAACGGCGCTATTGACGTCGACATCCCGGAAAACCTGAATATG
GAAAGCCCGACGGTGACCCTTATCTACGATGAGCAGGGCAAACTGCTGTGGGCGCAGCGTGATGTTCCATGGCTGGCGAA
ACGCATTCAACCGGAATGGCTGAAACGCAATGGCTTCCATGAGATTGAAGCCGATGTCGACAGCAGCAGTATGCTGTTGC
GCAATAACCATGAGATTCAGGAACAGCTGGACGCTATCCGCGAACAGGGCGACGACTCTGAGATGACCCACTCGGTGGCG
ATCAACCTCTACCCGGCCACCAGCAAAATGCCTCAGCTCAGCATTGTGGTGGTCGACACCATTCCGGTGGAGCTCAAGCG
CAGCTATATGGTGTGGAGCTGGTTTGTCTATGTGCTGGCCGCCAACCTGCTGCTGGTGATCCCCCTGCTGTGGGTCGCCG
CCTGGTGGAGCCTGCGGCCCATTGAGTCGCTGGCCAAAGAGGTGCGCGAACTGGAGGAACATCACCGCGAAAAGCTCAAT
CCCAACACCACTCGCGAGCTGACCCGGCTGGTCAGCAACCTCAACCGCCTGGTTCGCAGCGAGCGCGAACGCTATGACAA
ATACCGCACTACCCTCACCGATCTCACTCACAGTCTGAAAACGCCGCTGGCGGTGATGCAGAGTACACTGCGCTCGCTGC
GCGGCGAGAAGATCAGCGTCGACGAGGCGGAGCCGGTGATGCTGGAGCAGATAAGCCGCATCTCGCAGCAGATTGGTTAT
TACCTGCATCGCGCCAGCATGCGCAGCGGCGGCACCCTCTTGAGCCGGGAATTACACCCGATCGCCCCCCTGCTTGACAG
CCTGACTTCCGCTCTCAACAAGGTCTATCAGCGCAAAGGGGTCAATATCTCGCTCGACATCTCGCCGGAGATCACTTTTG
TCGGCGAGCAGAACGATTTTATGGAAGTGATGGGTAACGTTCTTGATAACGCCTGTAAGTATTGCCTGGAGTTCGTGGAA
GTTTCCGTGCGCCAGACCACCGACAGCCATCTGCACATCCTGGTGGAAGACGATGGGCCGGGGATCCCGCAGAGCCAGCG
CCGGGCCGTTTTCGACCGCGGCCAGCGGGCTGATACCCTGCGTCCCGGCCAGGGGGTAGGGCTCTCCGTTGCGCGTGAAA
TTGTCGAACAATATGATGGAGAGATCATCGCCGGGGAAAGCCTGCTCGGCGGCGCCTGCATGGAGGTGGTGTTTGGCCGC
CAGCAGATGGAAGATAAACAGAGTTAA