Detailed information of regulator


Summary

Regulator ID REG0320 experimental
Regulator type protein
Regulatory pathway (from literatures) Transcription regulator
KEGG pathway (determined by BlastKOALA) -
Related T6SS T6SS00002 experimental (Type i1)
Strain Vibrio cholerae O1 biovar El Tor str. N16961
Replicon chromosome
Sequence Protein sequence (81 a.a.); Nucleotide sequence (243 bp)
Description β-galactosidase activity assay show VCA0122 controls Hcp expression at the transcriptional level
Reference

External database links

Locus tag (Gene) VC_A0122
Coordinates (Strand) 137379..137621 (+)
NCBI ID 9657509
RefSeq NC_002506
Uniprot ID Q9KN43_VIBCH
KEGG ID vch:VC_A0122
KEGG pathway (determined by BlastKOALA) -
PDB ID -

  Target
Target Regulation (↓/↑) Target sequence
hcp-2 expression -

Pfam domain hit(s) of regulator

Domain Pfam ID E-value Aligned region

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-80 MIGARDCSVIRVNPGAKQGKVDKKLALSLPLTATQYFQRTIFNEPFSSNLRWPHIECYRRKKEQGKQHGKVTVSIKGGWP



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9767 - -



  Protein sequence of regulator: 81 a.a.    .

>REG0320 NC_002506:137379-137621 [Vibrio cholerae O1 biovar El Tor str. N16961]
MIGARDCSVIRVNPGAKQGKVDKKLALSLPLTATQYFQRTIFNEPFSSNLRWPHIECYRRKKEQGKQHGKVTVSIKGGWP
*

  Nucleotide sequence of regulator: 243 bp    .

>REG0320 NC_002506:137379-137621 [Vibrio cholerae O1 biovar El Tor str. N16961]
TTGATTGGGGCAAGGGATTGCTCAGTGATAAGAGTTAACCCTGGTGCGAAACAGGGAAAAGTAGACAAAAAGCTGGCATT
GAGTTTGCCATTGACTGCCACACAATATTTTCAACGCACCATTTTCAACGAACCATTTTCATCGAACTTAAGATGGCCAC
ATATCGAGTGCTATCGTCGAAAAAAAGAACAAGGAAAACAGCATGGCAAGGTTACAGTTTCAATTAAAGGTGGATGGCCT
TGA