Detailed information of regulator


Summary

Regulator ID REG0317 experimental
Regulator type protein
Regulatory pathway (from literatures) Global regulator
KEGG pathway (determined by BlastKOALA) Two-component system (map02020); Biofilm formation - Vibrio cholerae (map05111); Flagellar assembly (map02040)
Related T6SS T6SS00790 experimental (Type i1)
Strain Vibrio cholerae V52
Replicon chromosome
Sequence Protein sequence (488 a.a.); Nucleotide sequence (1464 bp)
Description The Dictyostelium-attenuated mutant SP109 carries a TnAraOut insertion on the large chromosome in Sigma-54 (VC2529) results that Sigma-54 controls transcriptional expression of one or more of the Dictyostelium virulence genes expressed by V52
Reference

External database links

Locus tag (Gene) VCV52_RS13040 (rpoN)
Coordinates (Strand) 216932..218395 (-)
NCBI ID 446727517
RefSeq NZ_KQ410502
Uniprot ID Q9KP49_VIBCH, A0A0X1L3Q8_VIBCO, A0A0H3AJL7_VIBC3, D7HFG5_VIBCL, A0A0K9URM2_VIBCL, A0A0H3Q430_VIBCL, C3LRJ2_VIBCM, A0A086SNJ1_VIBCL
KEGG ID vch:VC_2529, vcm:VCM66_2450, vcq:EN18_15695, vcx:VAA049_365, vco:VC0395_A2109
KEGG pathway (determined by BlastKOALA) map02020; map05111; map02040
PDB ID -

  Target
Target Regulation (↓/↑) Target sequence
Unknown -

Pfam domain hit(s) of regulator

Domain Pfam ID E-value Aligned region
Sigma54_DBD PF04552.15 5.8e-73 327..485
Sigma54_CBD PF04963.15 7.3e-59 128..315
Sigma54_AID PF00309.22 3.3e-17 4..49

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-487 MKPSLQLKLGQQLAMTPQLQQAIRLLQLSTLDLQQEIQEALESNPLLEVEENQDEAPSLDSVRMTEESPREPEELYEPEPQDSSDLIEKSEISAELEMDTTWDEVYSANTGSTGLALDDDAPIYQGETTQTLQDYLHWQLDLTPFSDVDRTIAVALIDAIDDYGYLTVSLEEIQESLRSDDIELDEIEAVRKRIQQFDPFGVASLNLQDCLLLQLTTYPCDTPWLEEARLLLSQYIDDLGNRDYKTILKETKLKEEDLREILQLIQQLDPRPGSRIAQDHAEYVIPDVSVYKEQGRWLVTINPDSVPKLKINQQYADLMRGNNAESNYIRTNLQEAKWLIKSLESRNETLLKVAKCIVEHQHDFFEYGEEAMKPMVLNDVAMAVEMHESTISRVTTQKYMHTPRGIFELKYFFSSHVSTDNGGECSSTAIRALIKKLVAAENPAKPLSDSKIATLLADQGIQVARRTIAKYRESLGIAPSSQRKRLL



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9820 - -



  Protein sequence of regulator: 488 a.a.    .

>REG0317 NZ_KQ410502:c218395-216932 [Vibrio cholerae V52]
MKPSLQLKLGQQLAMTPQLQQAIRLLQLSTLDLQQEIQEALESNPLLEVEENQDEAPSLDSVRMTEESPREPEELYEPEP
QDSSDLIEKSEISAELEMDTTWDEVYSANTGSTGLALDDDAPIYQGETTQTLQDYLHWQLDLTPFSDVDRTIAVALIDAI
DDYGYLTVSLEEIQESLRSDDIELDEIEAVRKRIQQFDPFGVASLNLQDCLLLQLTTYPCDTPWLEEARLLLSQYIDDLG
NRDYKTILKETKLKEEDLREILQLIQQLDPRPGSRIAQDHAEYVIPDVSVYKEQGRWLVTINPDSVPKLKINQQYADLMR
GNNAESNYIRTNLQEAKWLIKSLESRNETLLKVAKCIVEHQHDFFEYGEEAMKPMVLNDVAMAVEMHESTISRVTTQKYM
HTPRGIFELKYFFSSHVSTDNGGECSSTAIRALIKKLVAAENPAKPLSDSKIATLLADQGIQVARRTIAKYRESLGIAPS
SQRKRLL*

  Nucleotide sequence of regulator: 1464 bp    .

>REG0317 NZ_KQ410502:c218395-216932 [Vibrio cholerae V52]
ATGAAACCGTCATTACAGCTCAAGCTAGGTCAACAGTTAGCCATGACTCCGCAGCTCCAGCAGGCGATTCGTCTGTTGCA
GCTTTCGACGCTGGATCTGCAGCAAGAAATTCAGGAAGCATTGGAATCTAACCCCTTGTTAGAGGTGGAAGAGAACCAAG
ACGAAGCGCCATCGCTTGATAGCGTACGTATGACGGAAGAAAGCCCGCGCGAGCCAGAAGAACTCTACGAACCTGAACCG
CAGGATAGCTCGGATCTGATTGAAAAATCGGAAATCAGCGCTGAATTAGAGATGGATACCACTTGGGATGAAGTCTACAG
CGCCAATACTGGCAGTACAGGACTGGCACTCGATGATGATGCCCCTATCTACCAAGGCGAAACCACCCAAACCCTGCAAG
ATTATCTTCACTGGCAACTCGACTTAACTCCCTTTAGCGATGTGGATCGCACCATTGCCGTTGCACTTATCGATGCTATC
GACGATTACGGTTATTTAACCGTCTCACTAGAGGAGATCCAAGAGAGCCTGCGCAGTGATGACATTGAGTTGGATGAGAT
TGAAGCGGTACGTAAACGCATTCAGCAGTTTGACCCCTTTGGTGTGGCATCGCTTAATCTGCAAGACTGCTTGTTGCTGC
AACTCACCACCTATCCCTGTGATACTCCTTGGCTGGAAGAAGCGCGTTTACTGCTCTCACAGTACATCGATGATTTAGGG
AATCGCGATTACAAAACCATTCTGAAAGAGACTAAGCTCAAAGAAGAGGACTTGCGCGAGATCCTGCAACTCATCCAACA
GCTCGATCCTCGCCCCGGCAGTCGAATTGCCCAAGATCACGCTGAATACGTTATACCTGACGTGTCAGTCTATAAAGAAC
AAGGTCGATGGCTGGTCACCATCAACCCAGATAGTGTGCCTAAACTGAAGATCAATCAGCAGTATGCCGACCTGATGCGC
GGTAATAATGCGGAGAGCAACTACATCCGTACCAATTTGCAAGAGGCAAAATGGCTGATCAAAAGTTTAGAAAGTAGAAA
CGAGACACTGCTCAAAGTTGCCAAGTGCATAGTTGAACACCAACACGATTTCTTCGAGTATGGAGAAGAGGCGATGAAGC
CGATGGTGCTCAACGATGTGGCGATGGCGGTGGAAATGCATGAATCGACAATTTCGCGTGTCACCACGCAGAAATACATG
CATACCCCGCGCGGCATTTTTGAGTTGAAGTACTTTTTCTCCAGCCACGTCAGTACTGACAATGGCGGAGAGTGCTCGTC
CACTGCGATCAGGGCGCTGATCAAAAAACTGGTGGCGGCAGAGAATCCTGCCAAACCACTCAGTGACAGCAAGATCGCAA
CCCTACTCGCTGACCAAGGCATCCAAGTCGCGCGGCGAACCATCGCCAAATATCGTGAATCACTTGGCATCGCCCCATCA
AGTCAGCGCAAACGCCTGCTATAG