Detailed information of regulator


Summary

Regulator ID REG0315 experimental
Regulator type protein
Regulatory pathway (from literatures) Global regulator
KEGG pathway (determined by BlastKOALA) -
Related T6SS T6SS00790 experimental (Type i1)
Strain Vibrio cholerae V52
Replicon chromosome
Sequence Protein sequence (203 a.a.); Nucleotide sequence (609 bp)
Description -
Reference

External database links

Locus tag (Gene) VCV52_RS10780 (TfoX)
Coordinates (Strand) 68827..69435 (-)
NCBI ID 487807468
RefSeq NZ_KQ410501
Uniprot ID Q9KSV3_VIBCH, A0A0X1KVV8_VIBCO, A0A0H3AJZ6_VIBC3, D7H802_VIBCL, A0A0H3PX92_VIBCL, C3LLK0_VIBCM, A0A2K2UTX7_VIBCL
KEGG ID vch:VC_1153, vcm:VCM66_1109, vco:VC0395_A0723
KEGG pathway (determined by BlastKOALA) -
PDB ID -

  Target
Target Regulation (↓/↑) Target sequence
Unknown -

Pfam domain hit(s) of regulator

Domain Pfam ID E-value Aligned region
TfoX_C PF04994.15 2.3e-28 119..197
TfoX_N PF04993.15 4.3e-22 16..106

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-202 VIKGSMDMNEQQFFDYVTKFGAYQKRSMFGGIGLFQHDAMYVLVSEDRIFVRGGEELDPELLALGCEKYRHVKKQTTATVNYYDITELYEQHHPELDSIIERSIQFSVNQREFQRSAASRRLRDLPNMQLTLERMVKKAGIDDVETFMSLGAPEVFNKVRQAYGSDVDVKLLWKFAGAIEGIHWKLLQEPRKRQLLESCQQR



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9949 - -



  Protein sequence of regulator: 203 a.a.    .

>REG0315 NZ_KQ410501:c69435-68827 [Vibrio cholerae V52]
VIKGSMDMNEQQFFDYVTKFGAYQKRSMFGGIGLFQHDAMYVLVSEDRIFVRGGEELDPELLALGCEKYRHVKKQTTATV
NYYDITELYEQHHPELDSIIERSIQFSVNQREFQRSAASRRLRDLPNMQLTLERMVKKAGIDDVETFMSLGAPEVFNKVR
QAYGSDVDVKLLWKFAGAIEGIHWKLLQEPRKRQLLESCQQR*

  Nucleotide sequence of regulator: 609 bp    .

>REG0315 NZ_KQ410501:c69435-68827 [Vibrio cholerae V52]
GTGATTAAAGGATCAATGGATATGAATGAGCAACAGTTTTTCGACTACGTAACTAAGTTTGGCGCCTACCAAAAACGCTC
GATGTTTGGTGGTATTGGCTTGTTTCAACACGACGCTATGTATGTGTTGGTCAGTGAAGACCGCATTTTTGTGCGTGGTG
GAGAAGAGCTCGACCCTGAGCTCTTGGCCTTAGGGTGCGAGAAATATCGCCATGTTAAAAAACAGACAACGGCAACCGTA
AACTATTACGACATCACTGAACTGTATGAGCAACATCACCCTGAGCTAGACTCGATTATTGAACGCTCGATTCAGTTTTC
TGTGAATCAGCGGGAATTTCAACGCTCAGCAGCCAGTCGTCGTCTACGGGATTTACCCAATATGCAACTGACTTTGGAGC
GTATGGTAAAAAAAGCGGGCATTGACGATGTGGAAACTTTTATGAGCCTCGGTGCGCCAGAAGTGTTTAATAAGGTGCGT
CAAGCTTATGGAAGTGATGTCGATGTAAAACTACTGTGGAAGTTTGCGGGTGCGATTGAAGGCATTCACTGGAAACTGCT
GCAAGAGCCGCGTAAGCGCCAACTGTTAGAAAGTTGTCAGCAGCGTTAA