Detailed information of regulator


Summary

Regulator ID REG0311 experimental
Regulator type protein
Regulatory pathway (from literatures) c-di-GMP regulatory pathway
KEGG pathway (determined by BlastKOALA) Biofilm formation - Vibrio cholerae (map05111)
Related T6SS T6SS01112 experimental (Type i1)
Strain Vibrio cholerae strain A1552
Replicon chromosome
Sequence Protein sequence (685 a.a.); Nucleotide sequence (2055 bp)
Description LonA tempers motility and T6SS-dependent killing in V. cholerae by controlling cellular levels of TfoY. LonA regulates T6SS-dependent killing in WT, Δ2PDE, and Δ4DGC strains and that LonA-dependent regulation is most prominent when cellular c-di-GMP levels are low.
Reference

External database links

Locus tag (Gene) VCA1552_RS02130 (rocS)
Coordinates (Strand) 425233..427287 (-)
NCBI ID 447034155
RefSeq NZ_CP024867
Uniprot ID A0A0X1L399_VIBCO, A0A0H3AHX9_VIBC3, D7HD37_VIBCL, A0A0K9UUF1_VIBCL, A0A0H3Q975_VIBCL, C3LSQ8_VIBCM, A0A085T3V5_VIBCL
KEGG ID vco:VC0395_A0184, vcq:EN18_06220, vcx:VAA049_3037, vcm:VCM66_0611
KEGG pathway (determined by BlastKOALA) map05111
PDB ID -

  Target
Target Regulation (↓/↑) Target sequence
the levels of c-di-GMP -

Pfam domain hit(s) of regulator

Domain Pfam ID E-value Aligned region
EAL PF00563.22 8.5e-72 430..664
GGDEF PF00990.23 2.1e-43 256..409
PAS_4 PF08448.12 6.1e-07 18..122
PAS_8 PF13188.9 8.3e-05 135..183

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-684 MPAQTSSQLKHWFAKITSHSPFFFAILNDQHQYVMVNERYCDIAGLSSEEMVGMSDSQVLGEHFYRHLKPFYERAFNNEHIESELTLSEIDLETSLHFSLSPIMINDRVQYLVFHAIDTSEKQILVRSLEESESKYALLTTLLPDGLMMVENDCIISANPSAARLLGFDDAQKLLGENLSRLFIDEKTKTVFSSQLASLLTEKPLVCLTGPRCGFERKIQLHAGCTSLLGNQSQLILLQDADEAPKQFSATTQVDAHIDSLTGLYNRHGFTKRLEQCIQNETPLVMLYLDIDNFKNINDSLGHHIGDKVIKEVAARLKRLLPQQAVLGHLGGDEFGLILPEPEHNRSAEMLADRIISLINQPFDLHHFSKRLACSIGSVRYPGDGNDARVLLQNADTAMYEAKERGRNRLIKFNDQMNKEARMRLWLEIELQKALQQNGLEVWYQPKVNARDFSINGAEALVRWKHPVEGYISPGAFIPVAEKAGLIEHLGRVVMREVFATVKRWKLQGILPGRVAINISPEQFGNPQLIDYLEKLLRTTGLDPNNITFELTESAVMSDSEHTQQMLNAIKKLGFTLSIDDFGTGYSSLAYLARFPIDELKIDRAFISNIDTLPKQLTVIENIINLGRSLNLTVVAEGVETQQQATLLSNLNCHSIQGFHFYRPQPKHEVEELFAQNRRHRKSL



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9947 - -



  Protein sequence of regulator: 685 a.a.    .

>REG0311 NZ_CP024867:c427287-425233 [Vibrio cholerae]
MPAQTSSQLKHWFAKITSHSPFFFAILNDQHQYVMVNERYCDIAGLSSEEMVGMSDSQVLGEHFYRHLKPFYERAFNNEH
IESELTLSEIDLETSLHFSLSPIMINDRVQYLVFHAIDTSEKQILVRSLEESESKYALLTTLLPDGLMMVENDCIISANP
SAARLLGFDDAQKLLGENLSRLFIDEKTKTVFSSQLASLLTEKPLVCLTGPRCGFERKIQLHAGCTSLLGNQSQLILLQD
ADEAPKQFSATTQVDAHIDSLTGLYNRHGFTKRLEQCIQNETPLVMLYLDIDNFKNINDSLGHHIGDKVIKEVAARLKRL
LPQQAVLGHLGGDEFGLILPEPEHNRSAEMLADRIISLINQPFDLHHFSKRLACSIGSVRYPGDGNDARVLLQNADTAMY
EAKERGRNRLIKFNDQMNKEARMRLWLEIELQKALQQNGLEVWYQPKVNARDFSINGAEALVRWKHPVEGYISPGAFIPV
AEKAGLIEHLGRVVMREVFATVKRWKLQGILPGRVAINISPEQFGNPQLIDYLEKLLRTTGLDPNNITFELTESAVMSDS
EHTQQMLNAIKKLGFTLSIDDFGTGYSSLAYLARFPIDELKIDRAFISNIDTLPKQLTVIENIINLGRSLNLTVVAEGVE
TQQQATLLSNLNCHSIQGFHFYRPQPKHEVEELFAQNRRHRKSL*

  Nucleotide sequence of regulator: 2055 bp    .

>REG0311 NZ_CP024867:c427287-425233 [Vibrio cholerae]
ATGCCTGCTCAAACCTCATCTCAGCTCAAGCATTGGTTTGCAAAAATTACGTCACACAGTCCGTTCTTTTTTGCAATCCT
CAATGATCAACACCAATACGTGATGGTCAACGAGCGCTATTGTGATATCGCCGGTCTCTCTAGCGAAGAGATGGTCGGGA
TGAGCGATAGTCAGGTTCTGGGCGAACATTTTTATCGCCATCTCAAACCGTTTTACGAACGTGCGTTTAACAACGAGCAT
ATTGAGTCCGAGCTGACCCTCAGCGAAATCGACCTCGAAACCAGCTTACACTTTTCTCTCTCCCCCATCATGATCAACGA
TCGGGTGCAATACCTTGTATTCCACGCGATTGATACCTCAGAAAAGCAGATTTTAGTGCGCTCTCTGGAAGAATCGGAAA
GCAAATACGCACTCCTCACGACACTGCTACCTGATGGTTTAATGATGGTGGAAAATGACTGCATTATTTCTGCCAACCCT
TCCGCTGCACGTTTACTCGGTTTTGACGACGCACAAAAACTGCTCGGAGAAAATCTCTCCAGACTGTTTATTGATGAAAA
GACCAAAACCGTTTTTTCATCGCAGTTGGCTTCGCTACTGACAGAAAAACCCTTGGTGTGCTTGACCGGGCCAAGGTGTG
GGTTTGAACGGAAAATCCAGTTACACGCAGGTTGCACCTCTTTACTCGGTAATCAGTCGCAGTTGATCTTATTGCAAGAT
GCCGATGAAGCCCCAAAACAGTTTTCTGCGACCACTCAAGTCGATGCGCATATTGATAGCCTCACTGGGCTGTATAACCG
ACACGGGTTTACCAAGCGCTTAGAGCAGTGCATCCAAAATGAGACGCCTTTGGTTATGCTCTATCTGGACATTGATAACT
TCAAAAACATCAATGACTCTCTCGGCCATCACATCGGTGACAAAGTGATTAAAGAGGTGGCGGCACGTTTAAAACGCTTA
CTGCCACAGCAAGCCGTACTTGGCCATTTGGGCGGTGATGAGTTTGGTTTGATCTTGCCGGAGCCAGAACACAACCGCTC
TGCAGAAATGTTGGCAGATCGCATTATCTCTTTGATTAATCAGCCTTTTGACCTGCACCATTTCAGTAAGCGTTTAGCTT
GTTCGATTGGCAGCGTGCGTTATCCCGGTGACGGCAATGATGCTCGCGTATTACTGCAAAATGCCGATACCGCGATGTAT
GAGGCTAAAGAGCGCGGTCGCAATCGCCTGATCAAATTCAATGATCAGATGAACAAAGAAGCGCGGATGCGCCTTTGGTT
GGAAATTGAACTGCAAAAAGCGCTACAACAAAACGGCCTAGAAGTGTGGTACCAACCGAAAGTCAACGCGCGTGATTTTA
GCATCAATGGCGCAGAAGCCTTGGTACGCTGGAAACATCCCGTTGAAGGCTATATCAGCCCAGGTGCTTTCATTCCCGTT
GCGGAAAAAGCCGGCTTAATCGAACATTTGGGTCGCGTGGTTATGCGTGAAGTCTTCGCGACCGTCAAGCGCTGGAAGCT
ACAAGGCATTTTACCCGGACGTGTGGCGATCAACATCTCCCCCGAGCAGTTTGGCAATCCTCAACTGATTGATTATTTAG
AAAAACTACTGCGAACAACTGGGCTAGATCCCAACAACATCACATTTGAACTGACCGAAAGTGCGGTGATGAGCGATAGT
GAACATACCCAGCAAATGCTCAATGCCATCAAGAAACTCGGCTTCACCTTGTCAATTGATGACTTCGGTACAGGTTACTC
GTCGCTGGCTTATTTAGCTCGCTTCCCGATCGATGAGCTCAAAATCGACCGCGCGTTTATCAGTAATATCGACACTCTAC
CCAAACAGCTCACGGTGATTGAAAACATCATTAATTTGGGGCGCTCACTGAACCTGACCGTAGTTGCAGAAGGAGTAGAA
ACTCAGCAACAAGCCACTTTACTCTCCAACCTAAATTGCCACTCCATCCAAGGCTTCCATTTTTATCGCCCACAACCGAA
GCACGAAGTGGAAGAGTTGTTTGCGCAAAATCGCCGCCATCGCAAATCCCTCTAA