Detailed information of regulator


Summary

Regulator ID REG0309 experimental
Regulator type protein
Regulatory pathway (from literatures) c-di-GMP regulatory pathway
KEGG pathway (determined by BlastKOALA) Biofilm formation - Vibrio cholerae (map05111)
Related T6SS T6SS01112 experimental (Type i1)
Strain Vibrio cholerae strain A1552
Replicon chromosome
Sequence Protein sequence (490 a.a.); Nucleotide sequence (1470 bp)
Description LonA tempers motility and T6SS-dependent killing in V. cholerae by controlling cellular levels of TfoY. LonA regulates T6SS-dependent killing in WT, Δ2PDE, and Δ4DGC strains and that LonA-dependent regulation is most prominent when cellular c-di-GMP levels are low.
Reference

External database links

Locus tag (Gene) VCA1552_RS04310 (cdgK)
Coordinates (Strand) 901594..903063 (+)
NCBI ID 487807420
RefSeq NZ_CP024867
Uniprot ID Q9KT01_VIBCH, A0A0X1KVP6_VIBCO, A0A0H3AI47_VIBC3, A0A0K9USG1_VIBCL, A0A0H3PXH4_VIBCL, C3LU01_VIBCM, A0A0H5VS30_VIBCL
KEGG ID vcm:VCM66_1060, vch:VC_1104, vcq:EN18_08845, vco:VC0395_A0622
KEGG pathway (determined by BlastKOALA) map05111
PDB ID -

  Target
Target Regulation (↓/↑) Target sequence
the levels of c-di-GMP -

Pfam domain hit(s) of regulator

Domain Pfam ID E-value Aligned region
GGDEF PF00990.23 1.2e-36 335..486

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Inside 1-6 MNQRMS
Transmembrane helix 7-26 LTWIICAPLFIVFVLAASVF
Outside 27-304 QQYLYDLNQEIDDAYADIQQQLERAEKVVTALDYTFTHNQRPAENILFKHSARVVANVCQIKPIDGLVLAQGLSSSFAVPKLDLSYMLIGDASLCDSKPSHDPSLQIKLSMAPILSFLHDMDEYIYGVHYVDSSGYIISSPDTISEKVTYQQIKDFISESPLWSHAIAAPNMIAVDGPYRSVIREQHEWLLTLILPVYRDADYQGLVAVDIGLRELLSRMPHLASRFDMIDLNEMAIPTFAYRPHKLTSEYADYHQVVFYKLDIQSELSNFLTEKSGN
Transmembrane helix 305-322 LLVVALVYLFLTGVLIYL
Inside 323-489 NTRWDRQHYAQLAARDPMTGLLNRRGMESFLKGKRHSQYLAIAVLDIDDFKQINDAYGHDMGDRVICYIGEQIENHIRSSDAVARFGGEEFVVYVTAKEKEQITRIMQRIFDAVCRESPLILEPGFTISGGIEVVESTTDRSFEDLFKAADEKLYVAKTSGKNQLVY



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.6854 - -



  Protein sequence of regulator: 490 a.a.    .

>REG0309 NZ_CP024867:901594-903063 [Vibrio cholerae]
MNQRMSLTWIICAPLFIVFVLAASVFQQYLYDLNQEIDDAYADIQQQLERAEKVVTALDYTFTHNQRPAENILFKHSARV
VANVCQIKPIDGLVLAQGLSSSFAVPKLDLSYMLIGDASLCDSKPSHDPSLQIKLSMAPILSFLHDMDEYIYGVHYVDSS
GYIISSPDTISEKVTYQQIKDFISESPLWSHAIAAPNMIAVDGPYRSVIREQHEWLLTLILPVYRDADYQGLVAVDIGLR
ELLSRMPHLASRFDMIDLNEMAIPTFAYRPHKLTSEYADYHQVVFYKLDIQSELSNFLTEKSGNLLVVALVYLFLTGVLI
YLNTRWDRQHYAQLAARDPMTGLLNRRGMESFLKGKRHSQYLAIAVLDIDDFKQINDAYGHDMGDRVICYIGEQIENHIR
SSDAVARFGGEEFVVYVTAKEKEQITRIMQRIFDAVCRESPLILEPGFTISGGIEVVESTTDRSFEDLFKAADEKLYVAK
TSGKNQLVY*

  Nucleotide sequence of regulator: 1470 bp    .

>REG0309 NZ_CP024867:901594-903063 [Vibrio cholerae]
ATGAATCAGCGCATGAGTTTAACTTGGATTATCTGTGCGCCACTGTTTATCGTTTTTGTGCTGGCCGCATCGGTCTTTCA
GCAATATCTGTACGATCTTAACCAAGAAATTGACGACGCCTACGCTGACATTCAACAGCAGCTTGAGCGCGCCGAAAAAG
TGGTGACAGCGCTGGATTACACTTTCACGCATAATCAACGCCCGGCAGAGAATATATTGTTTAAACACTCAGCCCGTGTG
GTTGCGAATGTTTGCCAAATCAAACCGATAGATGGGTTAGTTCTGGCTCAGGGGCTGAGTTCCAGCTTTGCTGTTCCCAA
ATTAGATCTAAGTTATATGCTGATTGGGGATGCCTCGTTATGCGATTCCAAACCAAGTCATGATCCCAGTTTACAAATCA
AACTCTCCATGGCTCCTATACTCTCGTTTTTGCATGACATGGATGAATATATTTATGGTGTGCATTATGTGGATAGCAGC
GGTTATATCATTTCATCGCCGGATACCATCAGCGAAAAGGTAACCTATCAGCAAATTAAAGACTTTATCAGCGAGAGTCC
TTTGTGGAGCCATGCGATTGCTGCCCCCAATATGATTGCCGTTGATGGGCCTTATCGCTCAGTGATCAGAGAGCAACATG
AGTGGTTATTAACACTGATTCTGCCCGTTTACCGTGACGCGGATTATCAAGGACTCGTTGCGGTAGATATTGGTTTACGC
GAACTGCTTAGCCGCATGCCTCATTTAGCATCTCGTTTTGACATGATTGATTTGAATGAGATGGCTATTCCAACGTTTGC
CTATCGTCCACACAAGCTCACCAGTGAATATGCAGACTATCATCAGGTGGTATTTTATAAGTTGGATATTCAGTCCGAAT
TGAGCAATTTTCTTACTGAGAAGAGCGGTAATTTACTGGTCGTTGCTCTGGTGTACCTCTTTCTCACAGGCGTACTTATC
TATCTCAATACGCGCTGGGATCGCCAGCATTATGCGCAGCTCGCCGCGCGTGATCCGATGACGGGTTTACTCAATCGACG
TGGTATGGAAAGCTTTCTGAAAGGCAAACGCCACAGTCAATATTTAGCCATTGCCGTGTTGGATATCGATGACTTCAAAC
AGATCAATGATGCTTATGGTCATGATATGGGGGATAGAGTGATCTGCTACATTGGTGAGCAGATTGAAAACCATATTCGT
AGCTCAGATGCCGTGGCACGCTTTGGTGGCGAAGAATTTGTGGTTTATGTCACAGCAAAAGAAAAAGAGCAGATCACGAG
AATTATGCAGCGCATTTTTGATGCGGTTTGCCGCGAGTCCCCTTTAATACTAGAGCCAGGTTTTACCATCTCTGGTGGGA
TAGAGGTGGTTGAAAGTACAACCGATCGCAGTTTTGAAGATTTGTTTAAAGCCGCTGATGAAAAGTTGTATGTAGCGAAA
ACCAGCGGCAAAAATCAGTTGGTTTACTGA