Detailed information of regulator


Summary

Regulator ID REG0308 experimental
Regulator type protein
Regulatory pathway (from literatures) c-di-GMP regulatory pathway
KEGG pathway (determined by BlastKOALA) Biofilm formation - Vibrio cholerae (map05111)
Related T6SS T6SS01112 experimental (Type i1)
Strain Vibrio cholerae strain A1552
Replicon chromosome
Sequence Protein sequence (506 a.a.); Nucleotide sequence (1518 bp)
Description LonA tempers motility and T6SS-dependent killing in V. cholerae by controlling cellular levels of TfoY. LonA regulates T6SS-dependent killing in WT, Δ2PDE, and Δ4DGC strains and that LonA-dependent regulation is most prominent when cellular c-di-GMP levels are low.
Reference

External database links

Locus tag (Gene) VCA1552_RS10420 (cdgL)
Coordinates (Strand) 2215844..2217361 (-)
NCBI ID 446975354
RefSeq NZ_CP024867
Uniprot ID Q9KPS7_VIBCH, A0A0H3ANK2_VIBC3, A0A0K9UR18_VIBCL, C3LQ57_VIBCM
KEGG ID vcm:VCM66_2208, vco:VC0395_A1874, vch:VC_2285
KEGG pathway (determined by BlastKOALA) map05111
PDB ID -

  Target
Target Regulation (↓/↑) Target sequence
the levels of c-di-GMP -

Pfam domain hit(s) of regulator

Domain Pfam ID E-value Aligned region
GGDEF PF00990.23 3.8e-39 340..498
CHASE4 PF05228.15 1e-24 58..212

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-9 MNLNNFSLR
Transmembrane helix 10-30 WLTTLNALAVVLGFLMFYLTF
Inside 31-260 KYFWSHDREVAQVLQLQQAELQRVETLLSLERKAMGASLADYAAWDEMADFIAKPTLEFTQSNIGEHAFSSQFLDGVFIYDPEGNLVWGKKYDAATGQSSSYEHLLPDFSRILQQATRLSVDEISTSVRYMVVEDEPYLAATARVCDSDGKGCNKGFLIFIKKVRAQFANVVEQATGVDIEVLTCKNDAPLPQDEVDVSYIKQLDYSGNSSVLFKINHHIKHPPFIRTEE
Transmembrane helix 261-283 ILALLFFSLVMYLVNLWVVIALI
Outside 284-505 KPITTASQVLQQFKTSGGKMPDASTFISSEMKEFATTINRIVGQLEDSQQVLRWQSEHDPLTRISNRRHLEKQLKSYLSDRPQAYLVLFLVDIDFFKRFNDSFGHLAGDEALCSVADVLQSVEFHGEKIVARFGGEEFCVVLASDCAFDAEQYAQQMRSKIEQLAIANPVDALCQYLTVSIGGVYAISPKMESYLSLFHQADMALYHAKEHGRDRYVVRNFV



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9988 - -



  Protein sequence of regulator: 506 a.a.    .

>REG0308 NZ_CP024867:c2217361-2215844 [Vibrio cholerae]
MNLNNFSLRWLTTLNALAVVLGFLMFYLTFKYFWSHDREVAQVLQLQQAELQRVETLLSLERKAMGASLADYAAWDEMAD
FIAKPTLEFTQSNIGEHAFSSQFLDGVFIYDPEGNLVWGKKYDAATGQSSSYEHLLPDFSRILQQATRLSVDEISTSVRY
MVVEDEPYLAATARVCDSDGKGCNKGFLIFIKKVRAQFANVVEQATGVDIEVLTCKNDAPLPQDEVDVSYIKQLDYSGNS
SVLFKINHHIKHPPFIRTEEILALLFFSLVMYLVNLWVVIALIKPITTASQVLQQFKTSGGKMPDASTFISSEMKEFATT
INRIVGQLEDSQQVLRWQSEHDPLTRISNRRHLEKQLKSYLSDRPQAYLVLFLVDIDFFKRFNDSFGHLAGDEALCSVAD
VLQSVEFHGEKIVARFGGEEFCVVLASDCAFDAEQYAQQMRSKIEQLAIANPVDALCQYLTVSIGGVYAISPKMESYLSL
FHQADMALYHAKEHGRDRYVVRNFV*

  Nucleotide sequence of regulator: 1518 bp    .

>REG0308 NZ_CP024867:c2217361-2215844 [Vibrio cholerae]
ATGAATTTAAATAACTTTAGCCTACGCTGGCTAACGACACTCAATGCGTTAGCGGTGGTGTTAGGCTTTTTAATGTTTTA
TCTGACCTTTAAATATTTCTGGTCACATGATCGTGAAGTTGCGCAAGTGCTGCAGTTACAACAGGCCGAGTTGCAGCGGG
TTGAAACCTTGTTGTCGTTAGAACGTAAGGCGATGGGGGCTTCTTTGGCAGATTATGCCGCTTGGGATGAAATGGCAGAC
TTCATTGCAAAACCCACCCTTGAGTTCACACAAAGCAATATTGGAGAGCACGCTTTCAGTTCACAATTCCTCGATGGCGT
ATTTATCTATGATCCTGAGGGCAATTTGGTTTGGGGCAAGAAATATGACGCAGCAACGGGGCAGAGCTCTAGCTATGAGC
ACTTATTGCCGGATTTTTCACGTATTTTACAGCAGGCGACACGTTTAAGTGTGGATGAAATCTCGACTTCCGTTCGTTAT
ATGGTGGTGGAGGATGAGCCCTATTTAGCTGCCACGGCTCGTGTCTGTGACAGTGATGGGAAAGGGTGTAACAAAGGTTT
CTTAATCTTTATTAAAAAAGTCCGCGCCCAGTTTGCGAATGTGGTTGAGCAAGCCACTGGTGTCGATATTGAAGTCTTAA
CCTGTAAAAATGATGCGCCCTTACCGCAAGACGAAGTGGATGTTTCATACATCAAGCAACTCGATTACAGCGGTAATTCC
AGTGTGTTGTTTAAAATTAACCATCACATTAAGCATCCTCCCTTCATTCGAACCGAAGAAATTCTTGCTTTGCTGTTCTT
TTCACTGGTGATGTACTTAGTCAATTTATGGGTGGTGATTGCCTTGATCAAACCGATCACGACCGCCAGTCAAGTGTTGC
AACAATTTAAAACATCGGGCGGAAAAATGCCGGATGCGAGTACTTTTATCTCATCGGAGATGAAAGAATTTGCCACTACG
ATCAACCGAATCGTCGGACAATTGGAGGATAGTCAACAAGTGTTACGTTGGCAGTCTGAGCATGATCCACTAACCCGCAT
TTCCAATCGTCGCCATTTAGAAAAGCAGCTTAAAAGTTATTTGAGCGATCGTCCGCAAGCCTATCTGGTGCTGTTTCTTG
TCGATATCGATTTTTTCAAACGTTTCAATGACAGCTTTGGTCATTTGGCTGGCGATGAAGCCTTATGTTCCGTTGCTGAT
GTGCTCCAATCGGTGGAGTTCCATGGCGAGAAAATCGTGGCGCGCTTTGGGGGAGAAGAGTTTTGTGTTGTTTTAGCTTC
GGACTGTGCATTTGATGCAGAACAGTATGCACAACAGATGAGAAGCAAAATCGAGCAGCTCGCGATTGCAAATCCGGTTG
ATGCACTCTGCCAATATCTAACGGTGAGCATTGGTGGTGTGTATGCTATTTCTCCAAAGATGGAGTCTTATCTCTCTTTG
TTCCATCAGGCGGATATGGCACTTTATCATGCGAAAGAACACGGACGAGATCGATACGTTGTGCGAAATTTTGTCTAA