Detailed information of regulator


Summary

Regulator ID REG0306 experimental
Regulator type protein
Regulatory pathway (from literatures) c-di-GMP regulatory pathway
KEGG pathway (determined by BlastKOALA) -
Related T6SS T6SS01112 experimental (Type i1)
Strain Vibrio cholerae strain A1552
Replicon chromosome
Sequence Protein sequence (196 a.a.); Nucleotide sequence (588 bp)
Description TfoY-mediated increase in T6SS gene expression coincided with interbacterial killing
Reference

External database links

Locus tag (Gene) VCA1552_01510 (TfoY)
Coordinates (Strand) 1636980..1637567 (+)
NCBI ID 446282733
RefSeq NZ_CP024867
Uniprot ID Q9KRC0_VIBCH, A0A0X1KXG0_VIBCO, A0A0H3PZM2_VIBCL, A0A0H6P8L8_VIBCL
KEGG ID vch:VC_1722, vcq:EN18_11795
KEGG pathway (determined by BlastKOALA) -
PDB ID -

  Target
Target Regulation (↓/↑) Target sequence
Unknown -

Pfam domain hit(s) of regulator

Domain Pfam ID E-value Aligned region
TfoX_C PF04994.15 1.5e-32 115..194
TfoX_N PF04993.15 6.5e-30 12..103

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-195 MDKPVLKDSMRLFEQLGRVKSRSMFGGFGIFVDETMFALVVNDTLHIRADDATIEKYKQQGYEPYVYKKRGFPVVTKYYALPEDCWSHPDSILNEVRAALEVAKAERETQAQAKPDRLKDLPNLRLATERMLKKAGIDTVESLQTLGSVEAYKAVQRTHTAEVSLELLWALEGAIEGKHWSVIPQNRRDELLRHL



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9881 - -



  Protein sequence of regulator: 196 a.a.    .

>REG0306 NZ_CP024867:1636980-1637567 [Vibrio cholerae]
MDKPVLKDSMRLFEQLGRVKSRSMFGGFGIFVDETMFALVVNDTLHIRADDATIEKYKQQGYEPYVYKKRGFPVVTKYYA
LPEDCWSHPDSILNEVRAALEVAKAERETQAQAKPDRLKDLPNLRLATERMLKKAGIDTVESLQTLGSVEAYKAVQRTHT
AEVSLELLWALEGAIEGKHWSVIPQNRRDELLRHL*

  Nucleotide sequence of regulator: 588 bp    .

>REG0306 NZ_CP024867:1636980-1637567 [Vibrio cholerae]
ATGGATAAACCAGTATTAAAAGATTCAATGCGGCTCTTTGAGCAGCTAGGACGTGTTAAATCTCGTTCAATGTTTGGTGG
CTTTGGTATTTTCGTCGACGAAACTATGTTTGCGCTTGTGGTTAACGATACGCTGCACATCCGTGCAGATGACGCCACAA
TCGAAAAGTATAAACAGCAAGGTTATGAACCTTATGTTTACAAAAAACGTGGCTTCCCCGTTGTAACTAAGTACTACGCT
CTACCTGAAGATTGTTGGAGTCATCCAGACTCTATCCTCAATGAAGTGCGTGCAGCACTGGAGGTCGCTAAGGCCGAACG
TGAAACTCAAGCACAAGCGAAACCTGATCGTTTGAAAGATCTTCCTAACTTGCGTTTAGCAACAGAAAGAATGCTCAAAA
AAGCAGGTATCGACACCGTCGAGTCTCTTCAGACTCTTGGTTCTGTCGAAGCTTATAAAGCGGTTCAACGAACCCACACG
GCAGAGGTGAGTTTAGAGTTGCTATGGGCTCTAGAAGGCGCAATCGAAGGTAAACATTGGTCGGTGATCCCACAAAATCG
TCGTGATGAGCTATTAAGGCATCTCTGA