Detailed information of regulator


Summary

Regulator ID REG0303 experimental
Regulator type protein
Regulatory pathway (from literatures) c-di-GMP regulatory pathway; QS regulatory pathway; Global regulator
KEGG pathway (determined by BlastKOALA) Biofilm formation - Escherichia coli (map02026)
Related T6SS T6SS01112 experimental (Type i1)
Strain Vibrio cholerae strain A1552
Replicon chromosome
Sequence Protein sequence (215 a.a.); Nucleotide sequence (645 bp)
Description QstR is functional under low c-di-GMP concentration and directly regulates T6SS genes in its regulon by binding to DNA. Use VC0396 in Vibrio cholerae N16961 to describe VCA1552_00154 (QstR) in Vibrio cholerae A1552; QstR is functional under low c-di-GMP concentration and directly regulates T6SS genes in its regulon by binding to DNA; The requirement for VasH in the QstR-dependent T6SS activation showing that VasH is still necessary for TfoX-induced interbacterial killing. T6SS induction is required regulation by the QS regulator QstR. TfoX is able to drive VipA production and T6SS assembly; QstR is required for the TfoX-dependent induction of comEA, comEC and T6SS genes, and that it also acts in concert with HapR
Reference

External database links

Locus tag (Gene) VCA1552_00154 (QstR)
Coordinates (Strand) 149920..150564 (-)
NCBI ID 447111060
RefSeq NZ_CP024867
Uniprot ID Q9KUW3_VIBCH, A0A0X1L2N3_VIBCO, A0A0H3ALH4_VIBC3, D7HD98_VIBCL, A0A0K9UMZ8_VIBCL, A0A0H3Q739_VIBCL, C3LRC7_VIBCM, A0A0H6R3E4_VIBCL
KEGG ID vco:VC0395_A2814, vch:VC_0396, vcq:EN18_18975, vcm:VCM66_0381
KEGG pathway (determined by BlastKOALA) map02026
PDB ID -

  Target
Target Regulation (↓/↑) Target sequence
TssB/TfoY transcripts -
VC0396/VCA1552_00154 (QstR) -
T6SS transcripts -

Pfam domain hit(s) of regulator

Domain Pfam ID E-value Aligned region
GerE PF00196.21 3e-20 155..208

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-214 MQRANYARTIYLLTTQPKALHPSIQAAIEQLNLPVPVIEPERLLREYQSDKHKILLLDHAENGLIRQQLGPLKLTSPYFETILFNVEKRLRTEDLLTFGNLKGLFYANEDTGFIAHGLGEIINGQNWLPRHVSSQLLHYYRYAFQSHQVQATVDLTAREIQILRCLQTGASNMQIAENLFISEFTVKSHLYQIFKKLNVKNRVKAIAWVNQNLL



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.8457 - -



  Protein sequence of regulator: 215 a.a.    .

>REG0303 NZ_CP024867:c150564-149920 [Vibrio cholerae]
MQRANYARTIYLLTTQPKALHPSIQAAIEQLNLPVPVIEPERLLREYQSDKHKILLLDHAENGLIRQQLGPLKLTSPYFE
TILFNVEKRLRTEDLLTFGNLKGLFYANEDTGFIAHGLGEIINGQNWLPRHVSSQLLHYYRYAFQSHQVQATVDLTAREI
QILRCLQTGASNMQIAENLFISEFTVKSHLYQIFKKLNVKNRVKAIAWVNQNLL*

  Nucleotide sequence of regulator: 645 bp    .

>REG0303 NZ_CP024867:c150564-149920 [Vibrio cholerae]
ATGCAACGAGCCAACTATGCACGCACGATTTATTTATTAACGACACAGCCAAAAGCGTTACATCCCAGTATTCAAGCCGC
CATTGAGCAGTTGAATCTGCCCGTCCCGGTGATTGAACCAGAACGCTTATTGCGCGAGTATCAATCCGATAAACACAAAA
TATTGTTGCTCGACCATGCGGAAAATGGCCTGATTCGCCAGCAATTGGGTCCCCTAAAGCTTACCAGCCCGTACTTCGAA
ACCATCTTGTTTAATGTCGAGAAACGGTTAAGAACAGAAGATCTGCTCACTTTTGGCAACCTCAAAGGTCTGTTTTATGC
CAATGAAGACACAGGCTTTATTGCCCACGGTCTTGGGGAGATCATTAATGGCCAAAACTGGCTACCTCGCCATGTCAGCA
GTCAGTTGCTGCATTACTATCGTTACGCTTTCCAAAGCCATCAAGTTCAAGCCACGGTCGATTTGACTGCACGTGAAATT
CAGATCCTGCGCTGTTTACAAACTGGCGCATCGAATATGCAAATCGCTGAGAATTTATTTATTAGTGAGTTCACGGTGAA
ATCGCATCTTTATCAGATATTTAAAAAGCTAAACGTGAAAAATCGAGTCAAAGCGATCGCTTGGGTTAATCAAAATTTAC
TGTAA