Detailed information of regulator


Summary

Regulator ID REG0302 experimental
Regulator type protein
Regulatory pathway (from literatures) QS regulatory pathway; cAMP regulatory pathway
KEGG pathway (determined by BlastKOALA) Metabolic pathways (map01100); Purine metabolism (map00230); Biofilm formation - Vibrio cholerae (map05111); Biofilm formation - Escherichia coli (map02026)
Related T6SS T6SS01112 experimental (Type i1)
Strain Vibrio cholerae strain A1552
Replicon chromosome
Sequence Protein sequence (844 a.a.); Nucleotide sequence (2532 bp)
Description The expression of Hcp was abolished in the Δcya mutant.The adenylate cyclase enzyme encoded by the cya gene catalyzes formation of cAMP, which is indispensable for the function of CRP
Reference

External database links

Locus tag (Gene) VCA1552_RS12925 (cya)
Coordinates (Strand) 2747346..2749877 (-)
NCBI ID 447072406
RefSeq NZ_CP024867
Uniprot ID Q9KVL9_VIBCH, A0A0X1L4Y9_VIBCO, A0A0H3AIK5_VIBC3, A0A0K9UP80_VIBCL, C3LPW4_VIBCM, A0A0H4JPN5_VIBCL
KEGG ID vcq:EN18_16955, vcm:VCM66_0122, vco:VC0395_A2397, vch:VC_0122
KEGG pathway (determined by BlastKOALA) map01100; map00230; map05111; map02026
PDB ID -

  Target
Target Regulation (↓/↑) Target sequence
VCA1552_RS12025 (crp) 446164894

Pfam domain hit(s) of regulator

Domain Pfam ID E-value Aligned region
Adenylate_cycl PF01295.20 5.3e-262 226..829
Adenyl_cycl_N PF12633.9 1.2e-75 6..198

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-843 MQAYTQTLIHRLDKLNRQRIERALALMDLQSQRVFHLIPALFQFNHPLIPGYFSADTPFGIHLFEANPIQQQFIDDAQLTLGEPLTPADNPAILGLYTMGSTSSIGQSTSSDLDIWVCVSAQMSCEARDNLSSKCLLITDWAKSQGVEANFFIMNEERFRHNHSEALSGENCGSSQHLLLLDEFYRSAVRLAGKRLLWQIVPPEMEECYDEYVHELCSNGYLNCNEWIDFGKLNRIPAEEYFGANLWQLYKSIDSPYKSVLKAILLEAYSWEYPHTQLLSIDSKRRFFADEPDLYGMDSYYQMLEKVTRYLVRIGDSTRLDLVRRCFYLKTHEKLSREPGVGSMPWRREALRELTSEWQWSADLIAELDNRRHWKVEQVKVVHHALLDALMLSYRNLIQFARRNDITSAISPQDISILARKLYAAFEVLPGKVTLLNPQISPDLHEPDLSFIEVCAGRTNKPGWYLYKQPLQAQRLIGQPYLEHNEYLSKLVAWAFFNGLITESTRLHAVVREAQLDIDKFYQMVSDLRNTFSLRKRRPTMQALANPCEISQLAMFINFEHDPTSELSGKALKVDLKNIDIFSFGAEQKCLVGSVDLVYRNSWQEVRTLHFEGQTAMLDALKTVLGKMHQDALPPESVDVFCYSKNLRGVMRNLVYQLLAECIDLRLKPMEQEKRRRFKALRMGDQMYGLFFERRGVSVQKLENSVDFYRSISTNKLKGSPLLMLDRDQDYPLPAVVDSFASEGLVQFFFEDTEKGFNIYVLDEANRVEVYHQFNGEKDEMIASVNSFYTSMLDDSNKLGAKSINFNLPQYYQIIHPEEGETYVVPYRNDSAVYSKPSQVVNA



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9941 - -



  Protein sequence of regulator: 844 a.a.    .

>REG0302 NZ_CP024867:c2749877-2747346 [Vibrio cholerae]
MQAYTQTLIHRLDKLNRQRIERALALMDLQSQRVFHLIPALFQFNHPLIPGYFSADTPFGIHLFEANPIQQQFIDDAQLT
LGEPLTPADNPAILGLYTMGSTSSIGQSTSSDLDIWVCVSAQMSCEARDNLSSKCLLITDWAKSQGVEANFFIMNEERFR
HNHSEALSGENCGSSQHLLLLDEFYRSAVRLAGKRLLWQIVPPEMEECYDEYVHELCSNGYLNCNEWIDFGKLNRIPAEE
YFGANLWQLYKSIDSPYKSVLKAILLEAYSWEYPHTQLLSIDSKRRFFADEPDLYGMDSYYQMLEKVTRYLVRIGDSTRL
DLVRRCFYLKTHEKLSREPGVGSMPWRREALRELTSEWQWSADLIAELDNRRHWKVEQVKVVHHALLDALMLSYRNLIQF
ARRNDITSAISPQDISILARKLYAAFEVLPGKVTLLNPQISPDLHEPDLSFIEVCAGRTNKPGWYLYKQPLQAQRLIGQP
YLEHNEYLSKLVAWAFFNGLITESTRLHAVVREAQLDIDKFYQMVSDLRNTFSLRKRRPTMQALANPCEISQLAMFINFE
HDPTSELSGKALKVDLKNIDIFSFGAEQKCLVGSVDLVYRNSWQEVRTLHFEGQTAMLDALKTVLGKMHQDALPPESVDV
FCYSKNLRGVMRNLVYQLLAECIDLRLKPMEQEKRRRFKALRMGDQMYGLFFERRGVSVQKLENSVDFYRSISTNKLKGS
PLLMLDRDQDYPLPAVVDSFASEGLVQFFFEDTEKGFNIYVLDEANRVEVYHQFNGEKDEMIASVNSFYTSMLDDSNKLG
AKSINFNLPQYYQIIHPEEGETYVVPYRNDSAVYSKPSQVVNA*

  Nucleotide sequence of regulator: 2532 bp    .

>REG0302 NZ_CP024867:c2749877-2747346 [Vibrio cholerae]
TTGCAGGCTTATACTCAGACCTTAATCCATAGACTTGATAAGCTAAACCGGCAACGTATTGAGCGTGCGCTGGCTCTTAT
GGATTTGCAAAGTCAACGTGTTTTCCACCTCATTCCCGCACTATTTCAATTTAATCATCCTCTGATCCCCGGTTATTTTT
CTGCTGATACGCCTTTCGGTATCCATCTGTTTGAAGCCAATCCTATCCAGCAGCAATTCATCGATGATGCTCAGTTGACG
CTCGGCGAGCCGTTAACGCCAGCTGACAATCCGGCGATTTTAGGCTTGTATACGATGGGCAGTACCTCATCGATCGGTCA
AAGCACATCGAGCGATCTGGATATTTGGGTCTGTGTCTCTGCTCAAATGAGTTGTGAGGCGCGCGACAACCTCTCCAGTA
AATGTCTGCTCATTACCGATTGGGCGAAAAGTCAGGGTGTTGAAGCCAATTTCTTCATCATGAATGAAGAGCGTTTTCGC
CATAACCATTCCGAAGCGTTAAGCGGTGAAAACTGTGGTTCATCACAGCACTTATTATTATTGGATGAGTTTTATCGCTC
TGCGGTGCGCTTAGCGGGCAAGCGACTGCTGTGGCAAATCGTGCCACCAGAAATGGAAGAGTGCTACGACGAATATGTTC
ACGAGCTCTGTTCAAATGGGTATTTGAACTGCAATGAATGGATCGATTTTGGCAAGTTAAACCGCATTCCGGCTGAAGAG
TACTTTGGCGCGAACTTGTGGCAACTGTATAAGAGCATTGACTCGCCTTATAAATCGGTACTGAAAGCCATTTTGCTTGA
AGCCTATTCGTGGGAGTACCCGCACACTCAACTGTTGAGTATCGACAGCAAACGCCGTTTCTTTGCCGATGAACCGGATC
TGTACGGCATGGACTCTTACTATCAGATGTTAGAGAAAGTGACGCGCTATTTGGTGCGAATTGGTGATAGCACGCGCCTT
GATTTAGTGCGCCGCTGTTTCTATCTCAAAACCCATGAGAAGTTGTCGCGTGAGCCGGGCGTCGGCTCGATGCCTTGGCG
TCGTGAAGCGTTACGGGAACTGACCAGCGAATGGCAATGGAGCGCAGATTTGATTGCCGAGCTCGATAACCGTCGTCACT
GGAAAGTCGAGCAAGTGAAGGTCGTGCACCACGCACTGCTTGATGCCTTGATGCTCAGCTATCGTAACCTGATCCAGTTT
GCGCGTCGTAATGACATCACCTCGGCCATTAGCCCACAAGATATCTCGATTTTGGCGCGTAAACTGTACGCGGCGTTTGA
AGTGCTGCCGGGGAAAGTCACACTGCTCAACCCACAAATTTCCCCAGACCTGCATGAGCCCGATTTAAGTTTTATTGAGG
TTTGTGCTGGACGCACCAATAAGCCCGGTTGGTATCTCTACAAGCAGCCGCTGCAGGCGCAGCGCTTGATTGGTCAGCCG
TATCTTGAGCACAACGAATACTTGAGTAAATTGGTGGCTTGGGCCTTTTTTAATGGCCTGATCACTGAGTCGACTCGTTT
GCATGCGGTGGTGCGTGAAGCGCAGCTGGACATCGACAAGTTCTACCAAATGGTCAGCGATCTGCGTAATACCTTTTCGC
TGCGTAAGCGTCGCCCTACTATGCAAGCGCTGGCCAATCCTTGTGAGATTAGCCAGCTTGCCATGTTCATCAATTTTGAA
CACGACCCAACCAGTGAATTGAGTGGGAAAGCGCTGAAAGTCGACCTGAAAAATATCGATATTTTTAGTTTTGGTGCTGA
GCAGAAATGCTTAGTCGGCAGTGTCGATTTGGTGTATCGCAACTCGTGGCAAGAAGTGCGTACCCTGCATTTTGAAGGCC
AGACGGCCATGCTTGATGCGTTGAAAACCGTGCTTGGAAAAATGCATCAGGATGCGCTGCCGCCAGAATCGGTGGATGTG
TTCTGCTACAGCAAAAACTTGCGCGGCGTGATGCGTAACTTGGTTTATCAACTGTTGGCTGAGTGTATCGATTTGCGCCT
CAAGCCGATGGAGCAAGAGAAACGTCGTCGTTTCAAAGCGCTGCGCATGGGCGATCAGATGTATGGTTTGTTCTTTGAAC
GTCGTGGTGTTTCGGTTCAGAAGTTGGAGAACTCGGTTGATTTCTATCGCAGCATCTCAACCAATAAGCTCAAGGGCTCG
CCTTTACTGATGCTCGATCGCGATCAAGATTACCCATTGCCAGCGGTGGTGGATAGTTTTGCCAGTGAAGGTTTGGTGCA
GTTCTTCTTTGAAGATACCGAGAAAGGTTTCAACATCTATGTGCTTGATGAGGCCAACCGCGTTGAAGTCTATCACCAGT
TTAATGGCGAAAAAGACGAAATGATTGCCAGCGTCAACAGCTTCTACACCTCGATGTTGGATGACAGCAATAAACTCGGC
GCGAAAAGCATCAATTTTAACTTGCCGCAGTATTACCAAATCATCCACCCTGAAGAGGGAGAAACGTACGTGGTGCCGTA
CCGTAACGACAGCGCTGTGTATTCCAAGCCTTCGCAAGTGGTCAATGCCTAA