Detailed information of regulator


Summary

Regulator ID REG0301 experimental
Regulator type protein
Regulatory pathway (from literatures) QS regulatory pathway
KEGG pathway (determined by BlastKOALA) Two-component system (map02020); Quorum sensing (map02024); Biofilm formation - Vibrio cholerae (map05111); Biofilm formation - Pseudomonas aeruginosa (map02025); Biofilm formation - Escherichia coli (map02026)
Related T6SS T6SS01112 experimental (Type i1)
Strain Vibrio cholerae strain A1552
Replicon chromosome
Sequence Protein sequence (211 a.a.); Nucleotide sequence (633 bp)
Description The Hcp protein was not detectable in the Δcrp mutant by immunoblot analyses and Hcp expression was fully complemented when we tested the strain containing a crp + allele in trans.the carbon catabolite repressor, CRP (cAMP-receptor protein) is required for the biosynthesis of cholera autoinducer 1 (CAI-1) and affects the expression of multiple HapR-regulated genes.
Reference

External database links

Locus tag (Gene) VCA1552_RS12025 (crp)
Coordinates (Strand) 2558371..2559003 (+)
NCBI ID 446164894
RefSeq NZ_CP024867
Uniprot ID A0A067BGB0_VIBMT, Q9KNW6_VIBCH, A0A0X1L424_VIBCO, D7HFP5_VIBCL, A0A0K9UP11_VIBCL, A0A0H3Q7H6_VIBCL, C3LRS5_VIBCM, A0A085SDS8_VIBCL, D2YEF7_VIBMI, A0A1D8S8A2_VIBMI, D0IE16_9VIBR
KEGG ID vcx:VAA049_284, vcz:VAB027_1256, vcm:VCM66_2534, vch:VC_2614, vcq:EN18_16100, vmi:AL543_07930
KEGG pathway (determined by BlastKOALA) map02020; map02024; map05111; map02025; map02026
PDB ID -

  Target
Target Regulation (↓/↑) Target sequence
Hcp expression and secretion -

Pfam domain hit(s) of regulator

Domain Pfam ID E-value Aligned region
cNMP_binding PF00027.31 2.5e-23 23..109
HTH_Crp_2 PF13545.8 2.2e-13 142..206

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-210 MVLGKPQTDPTLEWFLSHCHIHKYPSKSTLIHAGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERTAWVRAKTPCEVAEISFKKFRQLIQVNPDILMRLSGQMARRLQVTSQKVGDLAFLDVTGRIAQTLLNLARQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEEQNLISAHGKTIVVYGTR



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9924 - -



  Protein sequence of regulator: 211 a.a.    .

>REG0301 NZ_CP024867:2558371-2559003 [Vibrio cholerae]
MVLGKPQTDPTLEWFLSHCHIHKYPSKSTLIHAGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEG
QERTAWVRAKTPCEVAEISFKKFRQLIQVNPDILMRLSGQMARRLQVTSQKVGDLAFLDVTGRIAQTLLNLARQPDAMTH
PDGMQIKITRQEIGQIVGCSRETVGRILKMLEEQNLISAHGKTIVVYGTR*

  Nucleotide sequence of regulator: 633 bp    .

>REG0301 NZ_CP024867:2558371-2559003 [Vibrio cholerae]
ATGGTTCTAGGTAAACCTCAAACCGATCCAACACTAGAGTGGTTTCTTTCACATTGTCACATTCATAAGTACCCATCAAA
AAGCACACTGATCCACGCGGGTGAGAAAGCGGAAACGCTGTACTACATCGTAAAAGGTTCAGTTGCGGTACTGATCAAAG
ATGAAGAAGGTAAAGAGATGATTCTCTCTTACCTGAACCAAGGTGATTTTATCGGTGAGCTTGGCTTGTTTGAAGAAGGC
CAAGAGCGTACAGCTTGGGTTCGTGCTAAAACACCTTGTGAAGTGGCTGAAATCTCATTTAAGAAATTCCGTCAATTGAT
CCAAGTAAACCCAGATATCTTGATGCGCCTTTCAGGTCAAATGGCTCGTCGTCTGCAAGTGACCAGCCAGAAAGTTGGCG
ACCTTGCGTTCCTAGACGTAACTGGCCGTATCGCACAGACTCTGCTGAATCTTGCACGTCAGCCAGATGCGATGACTCAC
CCTGACGGTATGCAAATCAAGATCACTCGCCAAGAGATCGGTCAAATTGTTGGCTGTTCTCGCGAAACCGTTGGCCGCAT
CCTGAAGATGCTGGAAGAGCAGAACCTGATCTCTGCCCACGGTAAAACCATCGTGGTTTACGGCACTCGCTAA