Detailed information of regulator


Summary

Regulator ID REG0298 experimental
Regulator type protein
Regulatory pathway (from literatures) QS regulatory pathway
KEGG pathway (determined by BlastKOALA) Metabolic pathways (map01100); Biosynthesis of amino acids (map01230); Cysteine and methionine metabolism (map00270); Quorum sensing (map02024); Biofilm formation - Vibrio cholerae (map05111); Biofilm formation - Escherichia coli (map02026)
Related T6SS T6SS01112 experimental (Type i1)
Strain Vibrio cholerae strain A1552
Replicon chromosome
Sequence Protein sequence (173 a.a.); Nucleotide sequence (519 bp)
Description The level of Hcp was reduced in the △cqsA and △luxS mutants where the level of the hapR expression was expected to be reduced
Reference

External database links

Locus tag (Gene) VCA1552_RS01665 (LuxS)
Coordinates (Strand) 319588..320106 (+)
NCBI ID 447052971
RefSeq NZ_CP024867
Uniprot ID LUXS_VIBCH, A0A0X1L333_VIBCO, LUXS_VIBC3, A0A0K9UHI4_VIBCL, A0A0H3Q5C9_VIBCL, LUXS_VIBCM, A0A085QVK5_VIBCL
KEGG ID vch:VC_0557, vcq:EN18_19785, vcz:VAB027_3286, vco:VC0395_A0091, vcm:VCM66_0515, vcr:VC395_0574
KEGG pathway (determined by BlastKOALA) map01100; map01230; map00270; map02024; map05111; map02026
PDB ID -

  Target
Target Regulation (↓/↑) Target sequence
Hcp expression and secretion -

Pfam domain hit(s) of regulator

Domain Pfam ID E-value Aligned region
LuxS PF02664.17 1.1e-58 4..153

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-172 MPLLDSFTVDHTRMNAPAVRVAKTMQTPKGDTITVFDLRFTMPNKDILSERGIHTLEHLYAGFMRNHLNGSQVEIIDISPMGCRTGFYMSLIGAPTEQQVAQAWLAAMQDVLKVESQEQIPELNEYQCGTAAMHSLEEAKAIAKNVIAAGISVNRNDELALPESMLNELKVH



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9889 - -



  Protein sequence of regulator: 173 a.a.    .

>REG0298 NZ_CP024867:319588-320106 [Vibrio cholerae]
MPLLDSFTVDHTRMNAPAVRVAKTMQTPKGDTITVFDLRFTMPNKDILSERGIHTLEHLYAGFMRNHLNGSQVEIIDISP
MGCRTGFYMSLIGAPTEQQVAQAWLAAMQDVLKVESQEQIPELNEYQCGTAAMHSLEEAKAIAKNVIAAGISVNRNDELA
LPESMLNELKVH*

  Nucleotide sequence of regulator: 519 bp    .

>REG0298 NZ_CP024867:319588-320106 [Vibrio cholerae]
ATGCCATTATTAGACAGTTTTACCGTCGATCATACTCGTATGAATGCACCGGCGGTGCGTGTTGCCAAAACCATGCAAAC
CCCAAAAGGGGATACGATTACCGTATTTGATTTGCGTTTTACTATGCCAAACAAAGATATCTTGTCTGAGCGCGGTATCC
ATACTCTAGAGCATCTCTACGCGGGCTTTATGCGCAATCACCTTAACGGCAGCCAAGTGGAGATCATCGATATTTCACCA
ATGGGTTGCCGTACAGGTTTCTACATGAGCTTGATTGGTGCGCCGACAGAACAGCAAGTGGCACAAGCATGGCTAGCCGC
AATGCAAGATGTGTTGAAAGTTGAAAGCCAAGAGCAAATTCCTGAGCTGAATGAGTACCAGTGCGGCACTGCGGCGATGC
ACTCGCTCGAAGAAGCCAAAGCGATTGCGAAAAACGTGATTGCGGCAGGCATCTCGGTTAACCGTAACGATGAGTTGGCG
CTGCCCGAATCTATGCTCAATGAGCTGAAGGTTCACTAA