Detailed information of regulator


Summary

Regulator ID REG0297 experimental
Regulator type protein
Regulatory pathway (from literatures) QS regulatory pathway
KEGG pathway (determined by BlastKOALA) Quorum sensing (map02024); Biofilm formation - Vibrio cholerae (map05111)
Related T6SS T6SS01112 experimental (Type i1)
Strain Vibrio cholerae strain A1552
Replicon chromosome
Sequence Protein sequence (390 a.a.); Nucleotide sequence (1170 bp)
Description The level of Hcp was reduced in the △cqsA(CAI-1 autoinducer synthase) and △luxS mutants where the level of the hapR expression was expected to be reduced
Reference

External database links

Locus tag (Gene) VCA1552_RS17020 (cqsa)
Coordinates (Strand) 455238..456407 (-)
NCBI ID 446962656
RefSeq NZ_CP024868
Uniprot ID CQSA_VIBCH, A0A0X1KZY9_VIBCO, A0A0K9UPP1_VIBCL, A0A0H3Q597_VIBCL, C3LVE0_VIBCM, A0A0H6DZT7_VIBCL
KEGG ID vcm:VCM66_A0482, vcq:EN18_01040, vcx:VAA049_2420, vch:VC_A0523
KEGG pathway (determined by BlastKOALA) map02024; map05111
PDB ID 2WK7, 2WK8, 2WK9, 2WKA, 3KKI, 3HQT

  Target
Target Regulation (↓/↑) Target sequence
Hcp expression and secretion -

Pfam domain hit(s) of regulator

Domain Pfam ID E-value Aligned region
Aminotran_1_2 PF00155.23 2.3e-30 41..375

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-389 MNKPQLPDFIQNKIDHYIENYFDINKNGKHLVLGKQASPDDIILQSNDYLALANHPLIKARLAKSLLEEQQSLFMSASFLQNDYDKPMIEKRLAKFTGFDECLLSQSGWNANVGLLQTICQPNTNVYIDFFAHMSLWEGARYANAQAHPFMHNNCDHLRMLIQRHGPGIIVVDSIYSTLGTIAPLAELVNISKEFGCALLVDESHSLGTHGPNGAGLLAELGLTREVHFMTASLAKTFAYRAGAIWCNNEVNRCVPFISYPAIFSSTLLPYEAAGLETTLEIIESADNRRQHLDRMARKLRIGLSQLGLTIRSESQIIGLETGDERNTEKVRDYLESNGVFGSVFCRPATSKNKNIIRLSLNSDVNDEQIAKIIEVCSDAVNYGDFYFR



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9967 - -



  Protein sequence of regulator: 390 a.a.    .

>REG0297 NZ_CP024868:c456407-455238 [Vibrio cholerae]
MNKPQLPDFIQNKIDHYIENYFDINKNGKHLVLGKQASPDDIILQSNDYLALANHPLIKARLAKSLLEEQQSLFMSASFL
QNDYDKPMIEKRLAKFTGFDECLLSQSGWNANVGLLQTICQPNTNVYIDFFAHMSLWEGARYANAQAHPFMHNNCDHLRM
LIQRHGPGIIVVDSIYSTLGTIAPLAELVNISKEFGCALLVDESHSLGTHGPNGAGLLAELGLTREVHFMTASLAKTFAY
RAGAIWCNNEVNRCVPFISYPAIFSSTLLPYEAAGLETTLEIIESADNRRQHLDRMARKLRIGLSQLGLTIRSESQIIGL
ETGDERNTEKVRDYLESNGVFGSVFCRPATSKNKNIIRLSLNSDVNDEQIAKIIEVCSDAVNYGDFYFR*

  Nucleotide sequence of regulator: 1170 bp    .

>REG0297 NZ_CP024868:c456407-455238 [Vibrio cholerae]
ATGAACAAGCCTCAACTTCCTGATTTTATTCAGAACAAGATAGATCACTATATTGAAAATTATTTTGATATAAACAAAAA
CGGTAAACACCTTGTATTGGGTAAACAAGCCAGCCCTGATGACATTATTTTGCAAAGTAATGATTATCTCGCATTGGCCA
ATCATCCGTTGATCAAAGCTCGTTTGGCGAAGTCATTACTGGAAGAACAACAAAGCTTATTTATGTCAGCCTCATTTCTA
CAAAATGACTATGACAAACCCATGATTGAGAAACGTCTGGCTAAGTTCACAGGCTTTGATGAATGTCTATTATCTCAATC
TGGTTGGAATGCAAACGTCGGTTTATTACAAACCATCTGCCAGCCCAATACGAATGTTTACATTGATTTTTTCGCGCACA
TGTCGTTATGGGAAGGGGCGCGCTACGCCAATGCTCAGGCGCATCCTTTTATGCATAATAACTGTGACCATTTACGTATG
CTGATTCAACGTCATGGTCCTGGGATCATTGTCGTAGACTCGATTTACAGCACTTTAGGTACGATTGCACCGCTAGCGGA
ACTGGTCAATATCAGTAAAGAGTTTGGCTGCGCCTTATTAGTCGATGAATCCCACTCTTTGGGCACACATGGCCCTAATG
GTGCAGGTTTATTGGCAGAATTAGGCCTCACTCGTGAAGTGCATTTTATGACCGCAAGTTTGGCCAAAACCTTTGCTTAT
CGCGCAGGAGCCATTTGGTGTAACAATGAAGTGAATCGCTGCGTTCCTTTTATTAGTTATCCAGCTATTTTTAGTTCTAC
TTTGCTGCCTTATGAAGCGGCAGGATTAGAAACGACTTTAGAGATTATTGAATCTGCGGATAATCGTCGTCAGCATTTAG
ATCGTATGGCAAGAAAATTACGCATAGGATTATCCCAGCTGGGATTAACCATTCGCAGTGAAAGCCAAATTATTGGTCTA
GAAACAGGAGATGAACGAAATACCGAAAAAGTTCGGGATTATTTAGAAAGTAATGGAGTGTTTGGCTCAGTATTCTGCCG
CCCGGCAACTTCAAAGAATAAAAACATTATTCGCTTATCACTCAATAGTGATGTGAACGATGAGCAAATCGCCAAAATAA
TTGAGGTTTGCTCTGATGCGGTCAACTACGGTGATTTTTATTTTCGTTAA