Detailed information of regulator


Summary

Regulator ID REG0296 experimental
Regulator type protein
Regulatory pathway (from literatures) QS regulatory pathway
KEGG pathway (determined by BlastKOALA) Two-component system (map02020); Quorum sensing (map02024); Biofilm formation - Vibrio cholerae (map05111)
Related T6SS T6SS01112 experimental (Type i1)
Strain Vibrio cholerae strain A1552
Replicon chromosome
Sequence Protein sequence (456 a.a.); Nucleotide sequence (1368 bp)
Description The expression of Hcp in the V. cholerae O1 strain was negatively regulated by the regulator LuxO
Reference

External database links

Locus tag (Gene) VCA1552_RS03895 (LuxO)
Coordinates (Strand) 818142..819509 (+)
NCBI ID 487814784
RefSeq NZ_CP024867
Uniprot ID LUXO_VIBCH, A0A0H3AGS8_VIBC3, C3LTR8_VIBCM, A0A0E4CK15_VIBCL
KEGG ID vch:VC_1021, vcq:EN18_08435, vco:VC0395_A0541, vcm:VCM66_0976
KEGG pathway (determined by BlastKOALA) map02020; map02024; map05111
PDB ID -

  Target
Target Regulation (↓/↑) Target sequence
Hcp expression and secretion -

Pfam domain hit(s) of regulator

Domain Pfam ID E-value Aligned region
Sigma54_activat PF00158.28 1.7e-68 133..298
Response_reg PF00072.26 1.7e-24 2..108
HTH_8 PF02954.21 6.7e-13 404..442

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-455 MVEDTASVAALYRSYLTPLDIDINIVGTGRDAIESIGRREPDLILLDLRLPDMTGMDVLYAVKEKSPDVPIVFMTAHGSIDTAVEAMRHGAQDFLIKPCEADRLRVTVNNAIRKASKLKNDVDNKNQNYQGFIGSSQTMQAVYRTIDSAASSKASIFITGESGTGKEVCAEAIHAASKRGDKPFIAINCAAIPKDLIESELFGHVKGAFTGAATERQGAAEAADGGTLFLDELCEMDLDLQTKLLRFIQTGTFQKVGSSKMKSVDVRFVCATNRDPWKEVQEGRFREDLYYRLYVIPLHLPPLRARGDDVIEIAYSLLGFMSKEEGKDFVRLSAEVVERFRQYEWPGNVRQLQNVLRNVVVLNEGREITLDMLPPPLNQMSAPINRALPLAHENKVSVHEIFPLWMTEKQAIEQAIEACDGNIPRAATYLDVSPSTIYRKLQTWNEKVKEKEKER



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9970 - -



  Protein sequence of regulator: 456 a.a.    .

>REG0296 NZ_CP024867:818142-819509 [Vibrio cholerae]
MVEDTASVAALYRSYLTPLDIDINIVGTGRDAIESIGRREPDLILLDLRLPDMTGMDVLYAVKEKSPDVPIVFMTAHGSI
DTAVEAMRHGAQDFLIKPCEADRLRVTVNNAIRKASKLKNDVDNKNQNYQGFIGSSQTMQAVYRTIDSAASSKASIFITG
ESGTGKEVCAEAIHAASKRGDKPFIAINCAAIPKDLIESELFGHVKGAFTGAATERQGAAEAADGGTLFLDELCEMDLDL
QTKLLRFIQTGTFQKVGSSKMKSVDVRFVCATNRDPWKEVQEGRFREDLYYRLYVIPLHLPPLRARGDDVIEIAYSLLGF
MSKEEGKDFVRLSAEVVERFRQYEWPGNVRQLQNVLRNVVVLNEGREITLDMLPPPLNQMSAPINRALPLAHENKVSVHE
IFPLWMTEKQAIEQAIEACDGNIPRAATYLDVSPSTIYRKLQTWNEKVKEKEKER*

  Nucleotide sequence of regulator: 1368 bp    .

>REG0296 NZ_CP024867:818142-819509 [Vibrio cholerae]
ATGGTAGAAGACACGGCGTCGGTGGCGGCGCTGTATCGTTCTTACCTCACACCGCTGGATATTGATATCAATATCGTGGG
TACCGGACGCGATGCCATCGAGAGTATTGGCCGTCGCGAGCCTGACTTAATCCTGCTGGATTTACGTTTGCCAGATATGA
CGGGGATGGACGTACTCTATGCAGTGAAAGAGAAATCACCGGATGTGCCTATCGTGTTTATGACCGCTCATGGTTCGATT
GATACGGCGGTTGAAGCCATGCGTCATGGTGCGCAAGACTTTTTGATCAAGCCGTGTGAAGCGGACCGACTGCGGGTCAC
AGTGAATAATGCGATTCGCAAAGCCTCGAAACTCAAAAACGATGTTGATAATAAAAATCAAAACTATCAAGGCTTTATTG
GTAGCAGTCAAACCATGCAGGCGGTGTACCGCACCATTGACTCTGCGGCGAGCAGCAAAGCCAGTATTTTTATTACCGGC
GAAAGTGGTACAGGTAAAGAAGTGTGCGCGGAAGCGATTCATGCCGCGAGCAAGCGTGGAGATAAGCCATTTATCGCCAT
CAACTGTGCGGCCATTCCGAAAGATCTGATTGAAAGTGAGTTGTTTGGTCACGTCAAAGGGGCTTTTACTGGGGCGGCGA
CTGAGCGTCAAGGCGCGGCAGAAGCGGCTGATGGGGGAACCCTCTTTTTGGATGAATTGTGCGAAATGGATCTGGATCTG
CAGACCAAACTTCTGCGCTTTATTCAGACAGGGACATTCCAAAAAGTCGGCTCTTCCAAAATGAAAAGCGTGGATGTGCG
TTTTGTGTGTGCAACGAACCGCGATCCGTGGAAGGAAGTGCAAGAAGGACGCTTTCGTGAAGACCTGTACTACCGCTTGT
ATGTGATCCCGCTGCATTTACCGCCATTGCGCGCGCGTGGTGATGATGTGATCGAGATTGCTTATTCACTGCTTGGCTTT
ATGTCCAAGGAAGAGGGCAAAGATTTTGTCCGTTTGTCGGCTGAAGTGGTGGAGCGTTTTCGCCAATACGAGTGGCCGGG
CAACGTGCGTCAATTGCAAAACGTTTTGCGCAACGTGGTTGTGCTCAATGAAGGTCGTGAAATCACCCTAGATATGCTGC
CTCCTCCTCTTAATCAAATGTCCGCGCCGATCAATCGGGCTTTACCGCTTGCGCATGAGAATAAAGTATCCGTGCATGAG
ATTTTTCCGCTGTGGATGACCGAAAAACAAGCCATTGAACAAGCCATCGAAGCGTGTGATGGCAACATTCCCCGTGCCGC
AACCTATCTGGATGTCAGCCCGTCAACCATCTATCGCAAGCTGCAAACTTGGAATGAAAAAGTGAAAGAAAAAGAGAAGG
AACGGTAA