Detailed information of regulator


Summary

Regulator ID REG0291 experimental
Regulator type protein
Regulatory pathway (from literatures) c-di-GMP regulatory pathway
KEGG pathway (determined by BlastKOALA) Biofilm formation - Vibrio cholerae (map05111)
Related T6SS T6SS01112 experimental (Type i1)
Strain Vibrio cholerae strain A1552
Replicon chromosome
Sequence Protein sequence (830 a.a.); Nucleotide sequence (2490 bp)
Description TfoY production is (at least in part) triggered by low c-di-GMP levels induced by a phosphodiesterase-encoding gene (cdpA).
Reference

External database links

Locus tag (Gene) VCA1552_02536 (CdpA/YfgF)
Coordinates (Strand) 2739669..2742158 (-)
NCBI ID 446417730
RefSeq NZ_CP024867
Uniprot ID CDPA_VIBCH, A0A0X1L532_VIBCO, A0A0K9UN25_VIBCL, A0A0H3Q6G2_VIBCL, C3LPX2_VIBCM, A0A0H6BDX2_VIBCL
KEGG ID vcm:VCM66_0130, vcq:EN18_16915, vch:VC_0130
KEGG pathway (determined by BlastKOALA) map05111
PDB ID -

  Target
Target Regulation (↓/↑) Target sequence
the levels of c-di-GMP -

Pfam domain hit(s) of regulator

Domain Pfam ID E-value Aligned region
EAL PF00563.22 3.3e-59 599..825
FIST PF08495.12 6.5e-20 30..215
GGDEF PF00990.23 3e-08 419..480
FIST_C PF10442.11 2e-07 220..340

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-829 MFTVSRLIPDLASANQVLETMDLPHGQSILVQIFSPLSREHVVQLARLIRSRHPQACLLGCSTEEVIFQGEVHHQVTLLQITVFEQTYLSRAVVDYSDDEAADAERLARQLELTSMSRAVVCFSWQMDTLQVARFALRDTQGAPVPVAGGAAKQTPSGRWVLLDEACYQNASVAIALHGEALYVETGGYTEWQPVGRTYRVTAVEGDRVLRLDDEPIEAIYQRNLGAQADLPHDWLISFPLMKGECRHQDLYLPLGLAEEGGLRFNRPLALQDEVRFCFDHPSLTLERVYLTAQQLQAKQCQQVWVFNCALRLNFMHENHELQPLQAVAPTDGCYCWGELLYEHGQQQVMHHSMTFLALREGAVRDDLVPIPLPSYPEGMTSPLFNLIRHAFHDLDAMTDNLAQQIRAQTSLLTASYRRDRRTGLPNRVVLRERLANFAANEHLIALKVTNFNQINEKYGYPVGDKLLRDLSEQFQVFLDQKLAGQSGLYAIGVGEWATVFRAKLDGKSIHSHFYQFVEQLEHVNFEPYGLPNVDYLSISLCAGLVSQGDFAEHSPDELLLRAIEARRYAFNNNHHFCNAARLKVQESVRQERLNWLSRVSRAVVRDDVVVYAQPICQARSHIVASYECLVRIEDEGEIILPGNFLPIITDTHLYTRLSRQMITHTFNMMRHRPEAFSINLSPQDLMSERTLQHLEAAIKSVADPARVGLEVLESEQIKDYGRMIEVCNHFRTLGATIIVDDFGSGYSNIDEIVKLEPQVIKLDGSLIRNIDQDVKQRRIAEQLVKLCQVLNAKTVAEFVHNQTVCRISEDMGVDYLQGYFLGRPSRLG



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9763 - -



  Protein sequence of regulator: 830 a.a.    .

>REG0291 NZ_CP024867:c2742158-2739669 [Vibrio cholerae]
MFTVSRLIPDLASANQVLETMDLPHGQSILVQIFSPLSREHVVQLARLIRSRHPQACLLGCSTEEVIFQGEVHHQVTLLQ
ITVFEQTYLSRAVVDYSDDEAADAERLARQLELTSMSRAVVCFSWQMDTLQVARFALRDTQGAPVPVAGGAAKQTPSGRW
VLLDEACYQNASVAIALHGEALYVETGGYTEWQPVGRTYRVTAVEGDRVLRLDDEPIEAIYQRNLGAQADLPHDWLISFP
LMKGECRHQDLYLPLGLAEEGGLRFNRPLALQDEVRFCFDHPSLTLERVYLTAQQLQAKQCQQVWVFNCALRLNFMHENH
ELQPLQAVAPTDGCYCWGELLYEHGQQQVMHHSMTFLALREGAVRDDLVPIPLPSYPEGMTSPLFNLIRHAFHDLDAMTD
NLAQQIRAQTSLLTASYRRDRRTGLPNRVVLRERLANFAANEHLIALKVTNFNQINEKYGYPVGDKLLRDLSEQFQVFLD
QKLAGQSGLYAIGVGEWATVFRAKLDGKSIHSHFYQFVEQLEHVNFEPYGLPNVDYLSISLCAGLVSQGDFAEHSPDELL
LRAIEARRYAFNNNHHFCNAARLKVQESVRQERLNWLSRVSRAVVRDDVVVYAQPICQARSHIVASYECLVRIEDEGEII
LPGNFLPIITDTHLYTRLSRQMITHTFNMMRHRPEAFSINLSPQDLMSERTLQHLEAAIKSVADPARVGLEVLESEQIKD
YGRMIEVCNHFRTLGATIIVDDFGSGYSNIDEIVKLEPQVIKLDGSLIRNIDQDVKQRRIAEQLVKLCQVLNAKTVAEFV
HNQTVCRISEDMGVDYLQGYFLGRPSRLG*

  Nucleotide sequence of regulator: 2490 bp    .

>REG0291 NZ_CP024867:c2742158-2739669 [Vibrio cholerae]
ATGTTTACGGTCTCGCGTCTCATCCCAGATTTAGCATCGGCCAATCAGGTGCTCGAAACGATGGATCTTCCTCATGGGCA
ATCCATCTTAGTGCAAATTTTCTCTCCTTTGAGTCGCGAGCATGTCGTGCAGCTTGCGCGGCTCATCCGTAGTCGCCATC
CACAAGCTTGCCTGCTTGGATGCAGTACCGAAGAGGTGATTTTCCAAGGGGAAGTGCACCATCAGGTGACGTTGCTGCAA
ATCACCGTGTTTGAGCAAACTTATCTTAGCCGTGCTGTTGTGGATTACAGTGACGATGAGGCTGCCGACGCGGAGCGTTT
AGCTCGCCAGCTCGAGCTCACTAGCATGTCTCGAGCAGTGGTCTGTTTTTCTTGGCAGATGGATACCTTGCAAGTCGCAC
GATTTGCCTTACGCGACACGCAGGGTGCGCCAGTGCCCGTCGCTGGTGGAGCCGCCAAACAAACTCCCAGTGGTCGCTGG
GTTTTGCTCGATGAGGCTTGTTATCAAAACGCCAGTGTGGCTATTGCGCTGCATGGCGAAGCGCTTTATGTCGAGACGGG
TGGTTACACTGAGTGGCAGCCTGTTGGGCGCACCTATCGGGTCACAGCCGTGGAGGGAGATCGGGTCTTACGTTTGGATG
ATGAGCCGATAGAGGCGATTTATCAGCGCAATTTGGGCGCGCAAGCCGACTTACCCCATGACTGGCTGATCAGTTTTCCA
CTGATGAAAGGGGAATGCCGCCACCAAGATCTTTATCTGCCGCTCGGGCTGGCGGAGGAAGGCGGACTGAGGTTTAACCG
CCCACTGGCGCTGCAAGATGAAGTGCGCTTTTGTTTTGATCACCCGAGTTTAACCCTAGAGCGGGTCTATCTCACCGCGC
AGCAACTACAAGCCAAGCAGTGCCAACAAGTGTGGGTGTTTAACTGTGCGCTGCGTTTAAACTTCATGCATGAGAATCAC
GAGTTACAACCGCTTCAGGCGGTGGCGCCGACCGATGGTTGTTACTGTTGGGGAGAGCTGCTGTATGAGCATGGTCAGCA
GCAAGTGATGCATCATAGCATGACGTTTCTTGCCTTGCGTGAAGGGGCGGTGCGTGACGATCTTGTCCCAATCCCCTTGC
CGAGTTATCCGGAAGGGATGACGTCCCCTCTGTTTAATTTGATCCGCCATGCGTTTCATGATTTGGATGCCATGACGGAC
AATTTGGCACAGCAGATCCGCGCTCAAACCTCATTACTGACGGCGAGTTACCGGCGTGACCGACGTACCGGCTTACCCAA
TCGAGTGGTGTTACGTGAGCGATTGGCGAACTTCGCGGCCAATGAGCACCTAATCGCCCTGAAAGTGACCAACTTCAATC
AGATCAATGAGAAGTACGGTTATCCGGTAGGCGATAAGCTGCTTCGTGATTTGAGTGAACAGTTTCAGGTCTTTTTGGAT
CAGAAATTGGCAGGGCAGAGCGGTTTGTATGCGATTGGGGTCGGTGAGTGGGCAACGGTTTTTCGTGCCAAGCTGGACGG
GAAAAGTATTCATAGCCATTTCTATCAGTTTGTGGAGCAGTTGGAGCACGTCAACTTCGAGCCCTACGGTTTACCGAATG
TGGATTATCTGTCGATCTCGTTGTGCGCTGGGTTAGTCAGTCAGGGCGATTTTGCAGAGCATTCGCCGGATGAGCTATTG
CTGCGTGCTATCGAAGCACGCCGCTACGCGTTTAACAACAACCACCATTTCTGTAATGCAGCGCGTTTAAAAGTGCAAGA
AAGTGTTCGTCAGGAGCGGCTGAATTGGCTATCGCGGGTTAGCCGCGCGGTGGTACGTGATGATGTGGTGGTTTATGCGC
AGCCGATTTGTCAGGCGCGTAGTCACATTGTGGCTTCCTACGAATGTTTAGTGCGGATTGAAGATGAAGGGGAAATTATC
TTGCCTGGGAATTTTCTCCCGATCATCACCGATACTCACCTCTATACTCGTTTGAGCCGGCAGATGATAACGCATACCTT
CAATATGATGCGTCATCGCCCGGAGGCGTTTTCGATCAATCTTTCACCGCAAGATTTGATGAGTGAGCGCACCTTGCAGC
ATTTGGAAGCGGCAATCAAATCGGTGGCCGATCCCGCCCGTGTCGGGCTCGAAGTGTTGGAGAGCGAACAAATCAAAGAT
TACGGGCGGATGATTGAAGTGTGTAACCATTTCCGCACACTGGGCGCGACCATCATTGTCGATGATTTTGGCAGTGGTTA
TTCCAATATTGATGAGATAGTGAAGCTTGAGCCGCAGGTGATTAAGCTCGATGGCAGCTTGATCCGCAATATTGATCAGG
ATGTGAAGCAGCGCCGGATTGCCGAGCAGCTCGTGAAATTGTGTCAGGTACTGAATGCGAAAACCGTGGCGGAGTTTGTC
CATAACCAGACGGTTTGTCGCATCAGTGAAGATATGGGTGTGGATTATTTACAAGGCTATTTCTTGGGTCGACCTTCACG
CTTGGGTTAA