Detailed information of regulator


Summary

Regulator ID REG0290 experimental
Regulator type protein
Regulatory pathway (from literatures) c-di-GMP regulatory pathway
KEGG pathway (determined by BlastKOALA) -
Related T6SS T6SS01112 experimental (Type i1)
Strain Vibrio cholerae strain A1552
Replicon chromosome
Sequence Protein sequence (430 a.a.); Nucleotide sequence (1290 bp)
Description TfoY production is (at least in part) inhibited by low c-di-GMP levels induced by a c-di-GMP-producing diguanylate cyclase-encoding gene (vdcA).
Reference

External database links

Locus tag (Gene) VCA1552_01380 (VdcA/ycdT)
Coordinates (Strand) 1482426..1483715 (+)
NCBI ID 446892247
RefSeq NZ_CP024867
Uniprot ID Q9KRP3_VIBCH, A0A0X1KX36_VIBCO, A0A0H3ALR2_VIBC3, A0A0H3Q6D7_VIBCL, C3LMS0_VIBCM, A0A0H6RNX3_VIBCL
KEGG ID vco:VC0395_A1195, vcm:VCM66_1533, vch:VC_1593
KEGG pathway (determined by BlastKOALA) -
PDB ID -

  Target
Target Regulation (↓/↑) Target sequence
the levels of c-di-GMP -

Pfam domain hit(s) of regulator

Domain Pfam ID E-value Aligned region
GGDEF PF00990.23 5.7e-35 267..410

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-9 MMDTDNRWR
Transmembrane helix 10-32 IALRSIRGELIIIGMIAVSIVLI
Inside 33-229 NTPKLLFEDKIHAYEKEQLQLTVELQKTRIDYASLILEHLETHSLTPQLQEFFNLYHGNLCVLDENSPQQCPLSIIDAVQSTTSASDFVASTSVNITFAEGSILFFQVQGKQIRVLWFNHASFWPAPQKNISLVLVRGNHIQFLDNPIAHYNALLNYTILRHRDDYGTLQFENMELSFLRWNLGEYQLISVFNDKVR
Transmembrane helix 230-252 LFNLIYWVMSASLTLLLTLTWFL
Outside 253-429 TRLNLQKVAAQRHVYIDNLTRLNNRHFLNKISTKFIEHPHSIAAMIDIDHFKKINDQYGHITGDRILQAVASCLRKNVRDGDTIIRFGGEEFLLLFQAHSNKEAWYMLDRLRQRVKDDHSLYGTTISIGFTFIDGSLPAAISRADTALYQAKEAGRNQVVADSEKENDSAADLPIQC



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9935 - -



  Protein sequence of regulator: 430 a.a.    .

>REG0290 NZ_CP024867:1482426-1483715 [Vibrio cholerae]
MMDTDNRWRIALRSIRGELIIIGMIAVSIVLINTPKLLFEDKIHAYEKEQLQLTVELQKTRIDYASLILEHLETHSLTPQ
LQEFFNLYHGNLCVLDENSPQQCPLSIIDAVQSTTSASDFVASTSVNITFAEGSILFFQVQGKQIRVLWFNHASFWPAPQ
KNISLVLVRGNHIQFLDNPIAHYNALLNYTILRHRDDYGTLQFENMELSFLRWNLGEYQLISVFNDKVRLFNLIYWVMSA
SLTLLLTLTWFLTRLNLQKVAAQRHVYIDNLTRLNNRHFLNKISTKFIEHPHSIAAMIDIDHFKKINDQYGHITGDRILQ
AVASCLRKNVRDGDTIIRFGGEEFLLLFQAHSNKEAWYMLDRLRQRVKDDHSLYGTTISIGFTFIDGSLPAAISRADTAL
YQAKEAGRNQVVADSEKENDSAADLPIQC*

  Nucleotide sequence of regulator: 1290 bp    .

>REG0290 NZ_CP024867:1482426-1483715 [Vibrio cholerae]
ATGATGGACACAGATAACCGCTGGAGAATTGCGCTTCGCTCTATACGAGGAGAACTGATCATTATCGGGATGATAGCGGT
CAGCATAGTATTGATTAACACGCCTAAATTATTGTTTGAAGATAAGATCCACGCTTATGAAAAAGAGCAATTGCAACTGA
CTGTCGAACTACAGAAAACCCGTATTGACTACGCAAGCCTAATTCTAGAACATCTAGAAACCCACTCATTGACTCCACAG
TTGCAAGAATTCTTCAATCTGTACCATGGCAATTTATGTGTGCTGGATGAGAATTCCCCACAACAATGCCCGTTGAGCAT
TATCGATGCGGTTCAATCCACCACTTCAGCAAGTGATTTTGTCGCTTCTACCTCAGTAAACATCACGTTTGCAGAAGGTT
CTATCCTATTTTTTCAAGTGCAAGGCAAACAGATCCGAGTGCTATGGTTCAACCATGCTTCATTTTGGCCAGCACCACAG
AAAAACATCAGCTTGGTCTTGGTTCGCGGTAATCACATTCAGTTCTTAGATAATCCGATTGCACACTATAACGCTCTACT
GAATTACACGATTTTGCGCCACCGAGATGATTACGGGACTTTGCAGTTTGAAAACATGGAGTTGAGCTTTCTTCGTTGGA
ACCTTGGTGAATATCAATTGATCAGTGTGTTTAACGACAAAGTACGCTTGTTTAATCTTATTTACTGGGTAATGTCGGCC
AGTTTAACCCTGTTACTGACTTTGACTTGGTTCCTCACTCGACTCAATCTACAAAAAGTAGCGGCGCAGCGTCATGTTTA
TATCGACAACTTAACTCGGCTCAATAACCGACATTTTCTGAATAAAATCAGTACTAAGTTTATTGAACACCCTCACTCCA
TTGCCGCGATGATCGACATCGATCACTTTAAGAAAATTAATGACCAATATGGGCACATTACCGGAGATCGCATTCTACAG
GCGGTGGCCTCTTGTCTGCGCAAAAATGTCCGAGATGGAGACACCATTATCCGCTTTGGTGGAGAAGAGTTTTTACTATT
GTTCCAAGCCCATTCAAACAAAGAAGCTTGGTACATGCTCGACCGATTGCGTCAGCGAGTTAAAGACGATCATAGCTTGT
ACGGAACAACGATTTCGATTGGTTTTACTTTTATCGATGGTAGTTTACCCGCTGCTATTTCGCGGGCAGATACTGCACTC
TATCAAGCAAAAGAAGCAGGACGTAATCAAGTGGTTGCCGACAGCGAGAAAGAGAATGACTCAGCAGCAGATTTACCGAT
TCAGTGCTGA