Detailed information of regulator


Summary

Regulator ID REG0289 experimental
Regulator type protein
Regulatory pathway (from literatures) c-di-GMP regulatory pathway
KEGG pathway (determined by BlastKOALA) -
Related T6SS T6SS00002 experimental (Type i1)
Strain Vibrio cholerae O1 biovar El Tor str. N16961
Replicon chromosome
Sequence Protein sequence (71 a.a.); Nucleotide sequence (213 bp)
Description cspV affects the level of c-di-GMP, possibly through upregulation of the phosphodiesterase gene rocS.And ΔcspV strain exhibited a significant decrease in T6SS-mediated killing of E. coli, comparable to that of the Δhcp mutant, at 37°C and 25°C, while no killing was observed at 15°C in any of the strains.
Reference

External database links

Locus tag (Gene) VCA0933 (CspV)
Coordinates (Strand) 886068..886280 (+)
NCBI ID 446027150
RefSeq NC_002506
Uniprot ID CSPV_VIBCH, A0A085QG16_VIBCL, A0A0H3AEQ6_VIBC3, A0A0H3Q5W6_VIBCL, A0A0K9UW31_VIBCL, A0A0X1L0T7_VIBCO, C3LWJ7_VIBCM, D7HBL1_VIBCL
KEGG ID vcx:VAA049_2057, vco:VC0395_0306, vcq:EN18_02945, vcz:VAB027_1189, vcm:VCM66_A0893, vch:VCA0933
KEGG pathway (determined by BlastKOALA) -
PDB ID -

  Target
Target Regulation (↓/↑) Target sequence
Unknown -

Pfam domain hit(s) of regulator

Domain Pfam ID E-value Aligned region
CSD PF00313.24 3.3e-29 5..69

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Inside 1-70 MSTKMTGSVKWFNETKGFGFLTQDNGGNDVFVHFNSIQSEGFKTLAEGQRVSFIVEQGKKGPQASNVVAL



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9881 - -



  Protein sequence of regulator: 71 a.a.    .

>REG0289 NC_002506:886068-886280 [Vibrio cholerae O1 biovar El Tor str. N16961]
MSTKMTGSVKWFNETKGFGFLTQDNGGNDVFVHFNSIQSEGFKTLAEGQRVSFIVEQGKKGPQASNVVAL*

  Nucleotide sequence of regulator: 213 bp    .

>REG0289 NC_002506:886068-886280 [Vibrio cholerae O1 biovar El Tor str. N16961]
ATGTCTACTAAAATGACTGGTTCTGTAAAATGGTTCAACGAAACTAAAGGTTTCGGTTTTCTTACTCAAGACAACGGTGG
CAACGATGTGTTTGTTCACTTTAATTCTATTCAGTCAGAAGGTTTCAAAACCTTAGCTGAAGGTCAACGTGTTAGCTTTA
TCGTTGAACAAGGTAAGAAAGGCCCTCAAGCGTCTAACGTAGTCGCACTGTAA