Detailed information of regulator


Summary

Regulator ID REG0288 experimental
Regulator type protein
Regulatory pathway (from literatures) TCS-RR
KEGG pathway (determined by BlastKOALA) -
Related T6SS T6SS00002 experimental (Type i1)
Strain Vibrio cholerae O1 biovar El Tor str. N16961
Replicon chromosome
Sequence Protein sequence (219 a.a.); Nucleotide sequence (657 bp)
Description VxrB activates expression of the T6SS genes. Use Vibrio cholerae O1 biovar El Tor str. N16961 gene information as Vibrio cholerae O1 El Tor A1552 annotation
Reference

External database links

Locus tag (Gene) VCA0566 (VxrB)
Coordinates (Strand) 504728..505384 (+)
NCBI ID 446737785
RefSeq NC_002506
Uniprot ID A0A0F4FFH1_VIBCL, A0A0K9UPH6_VIBCL
KEGG ID vcq:EN18_01245
KEGG pathway (determined by BlastKOALA) -
PDB ID -

  Target
Target Regulation (↓/↑) Target sequence
Unknown -

Pfam domain hit(s) of regulator

Domain Pfam ID E-value Aligned region
Trans_reg_C PF00486.30 6.2e-24 145..216
Response_reg PF00072.26 4.4e-17 6..112

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-218 VKQTLLLVEDDKNLADGLLVSLEQAGYDCLHAETIADVKQHWDKADLVILDRQLPDGDSVQHLMDWKKIKDIPVILLTALVTVKDKVTGLDAGANDYLTKPFAEAELFARIRAQLRSPDSGQDDSKVVTSNLTIDKATREVFFNGESITLTRTEFDLLLFLASNLGRVFTRDELLDHVWGYNHFPTTRTVDTHVLQLRQKLPGLEIETLRGVGYKMKA



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9950 - -



  Protein sequence of regulator: 219 a.a.    .

>REG0288 NC_002506:504728-505384 [Vibrio cholerae O1 biovar El Tor str. N16961]
VKQTLLLVEDDKNLADGLLVSLEQAGYDCLHAETIADVKQHWDKADLVILDRQLPDGDSVQHLMDWKKIKDIPVILLTAL
VTVKDKVTGLDAGANDYLTKPFAEAELFARIRAQLRSPDSGQDDSKVVTSNLTIDKATREVFFNGESITLTRTEFDLLLF
LASNLGRVFTRDELLDHVWGYNHFPTTRTVDTHVLQLRQKLPGLEIETLRGVGYKMKA*

  Nucleotide sequence of regulator: 657 bp    .

>REG0288 NC_002506:504728-505384 [Vibrio cholerae O1 biovar El Tor str. N16961]
GTGAAACAGACACTGCTTCTCGTTGAAGATGATAAAAACCTCGCTGACGGTCTACTCGTCAGTTTAGAGCAAGCCGGTTA
TGACTGTTTACATGCAGAAACGATCGCAGATGTGAAACAGCATTGGGACAAGGCGGATCTCGTTATCCTTGATCGCCAAC
TGCCTGATGGTGATTCTGTACAGCATCTAATGGATTGGAAAAAAATTAAAGATATCCCAGTGATTCTTTTAACTGCATTG
GTCACAGTAAAAGACAAAGTGACTGGCCTTGATGCAGGCGCAAACGACTATCTCACTAAACCTTTTGCAGAAGCTGAGCT
GTTTGCACGTATCCGCGCACAGCTGCGCTCACCAGATAGTGGGCAAGATGACAGTAAAGTGGTGACGTCTAACTTAACAA
TTGATAAAGCGACTCGTGAAGTTTTCTTCAATGGCGAATCGATCACCCTAACTCGAACCGAGTTTGATTTACTGCTCTTT
TTAGCGAGTAATTTAGGCCGAGTATTTACTCGCGATGAATTACTGGATCACGTATGGGGATATAACCATTTCCCGACGAC
GCGCACCGTAGATACTCACGTTTTGCAGCTGCGCCAAAAGTTGCCTGGGCTTGAAATTGAAACGCTACGCGGTGTTGGTT
ACAAAATGAAAGCGTGA