Detailed information of regulator

Summary

Regulator ID	REG0287
Regulator type	protein
Regulatory pathway (from literatures)	QS regulatory pathway
KEGG pathway (determined by BlastKOALA)	Quorum sensing (map02024); Biofilm formation - Vibrio cholerae (map05111)
Related T6SS	T6SS00939 (Type i5)
Strain	Vibrio alginolyticus 12G01
Replicon	chromosome
Sequence	Protein sequence (192 a.a.); Nucleotide sequence (576 bp)
Description	EMSAs and DNase I footprinting assay on both strands of PvqsA confirmed aphA Bindind Site(ABS).
Reference	[1] Gao X, Wang X, Mao Q, et al. VqsA, a Novel LysR-Type Transcriptional Regulator, Coordinates Quorum Sensing (QS) and Is Controlled by QS To Regulate Virulence in the Pathogen Vibrio alginolyticus. Appl Environ Microbiol. 2018 May 31;84(12). pii: e00444-18. doi: 10.1128/AEM.00444-18. Print 2018 Jun 15. PMID: 29625990

---

External database links

Locus tag (Gene)	V12G01_14830 (aphA)
Coordinates (Strand)	42305..42880 (+)
NCBI ID	91188695
GenBank	AAPS01000027
Uniprot ID	UPI0000D54ABF
KEGG ID	-
KEGG pathway (determined by BlastKOALA)	map02024; map05111
PDB ID	-

---

  Target

Target	Regulation (↓/↑)	Target sequence
V12G01-18672 (vqsA) promotor		TCGCTTTGCATATCAA EMSAs and DNase I footprinting assay on both strands of PvqsA confirmed aphA Bindind Site(ABS)

---

Pfam domain hit(s) of regulator

Domain	Pfam ID	E-value	Aligned region
PadR	PF03551.16	1.4e-15	19..92
Vir_act_alpha_C	PF10400.11	6.5e-15	104..188

---

Transmembrane helices

• Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction	Region	Sequence
Outside	1-191	MFTSLLTIWIEDMSLPHVILTVLSTRDATGYDITKEFSASIGYFWKASHQQVYRELNKMAEKELVTCVLEPQEGKPDRKVYSITDAGRSALGEWFDQPTAHPTVRDEFSAKLMACAVQPAAPFRDQLAELVEESRKLVSHYKEIEAAYYATPSTLDKQARLERLTLRRNLLLRETWITWAEEVLTELEVIG

---

Signal peptides

Prediction	Probability	Cleavage site	Signal peptide sequence
Other	0.9665	-	-

---

  Protein sequence of regulator: 192 a.a.    .Download


  Nucleotide sequence of regulator: 576 bp    .Download