Detailed information of regulator


Summary

Regulator ID REG0274 experimental
Regulator type protein
Regulatory pathway (from literatures) TCS regulatory pathway
KEGG pathway (determined by BlastKOALA) Cationic antimicrobial peptide (CAMP) resistance (map01503)
Related T6SS T6SS00937 experimental (Type i1)
Strain Escherichia coli RS218
Replicon chromosome
Sequence Protein sequence (237 a.a.); Nucleotide sequence (711 bp)
Description The overexpression of NlpE significantly upregulated the transcription of hcp2B, vgrG and xmtU genes in the wild-type strain (P < 0.001) but not the mutant strain ΔcpxR.Use E.coli RS218 as DE719 gene annotation
Reference

External database links

Locus tag (Gene) W817_01610 (NplE)
Coordinates (Strand) 214947..215657 (+)
NCBI ID 446161331
RefSeq NZ_CP007149
Uniprot ID S1PDX3_ECOLX, A0A0E2LA46_ECOU3, Q1RFZ6_ECOUT, A0A0H2YVR3_ECOK1, A0A0D8VNU0_ECOLX, B7UJ94_ECO27, B7MBH4_ECO45, B7MP53_ECO81
KEGG ID ecz:ECS88_0204, ecg:E2348C_0198, ecv:APECO1_1795, ecq:ECED1_0199, eci:UTI89_C0208
KEGG pathway (determined by BlastKOALA) map01503
PDB ID -

  Target
Target Regulation (↓/↑) Target sequence
W817_RS21690 (CpxA) 446502563

Pfam domain hit(s) of regulator

Domain Pfam ID E-value Aligned region
NlpE_C PF17185.6 2.6e-32 144..232
NlpE PF04170.14 5.7e-27 45..129

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-236 MVKKAIVTAMAVISLFTLMGCNNRAEVDTLSPAQAAELKPMPQSWRGVLPCADCEGIETSLFLEKDGTWVMNERYLGAREEPSSFASYGTWARTADKLVLTDSKGEKSYYRAKGDALEMLDREGNPIESQFNYTLEPAQSSLPMTPMTLRGMYFYMADAATFTDCATGKRFMVANNAELERGYLAARGNSEKPVLLSVEGHFTLEANPDTGAPTKVLAPDTAGKFYPNQDCSSLGL



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
LIPO(Sec/SPII) 0.9980 pos: 20-21. LMG-CN. MVKKAIVTAMAVISLFTLMG



  Protein sequence of regulator: 237 a.a.    .

>REG0274 NZ_CP007149:214947-215657 [Escherichia coli RS218]
MVKKAIVTAMAVISLFTLMGCNNRAEVDTLSPAQAAELKPMPQSWRGVLPCADCEGIETSLFLEKDGTWVMNERYLGARE
EPSSFASYGTWARTADKLVLTDSKGEKSYYRAKGDALEMLDREGNPIESQFNYTLEPAQSSLPMTPMTLRGMYFYMADAA
TFTDCATGKRFMVANNAELERGYLAARGNSEKPVLLSVEGHFTLEANPDTGAPTKVLAPDTAGKFYPNQDCSSLGL*

  Nucleotide sequence of regulator: 711 bp    .

>REG0274 NZ_CP007149:214947-215657 [Escherichia coli RS218]
ATGGTGAAAAAAGCGATAGTGACAGCGATGGCTGTAATCAGCCTCTTTACTCTGATGGGATGTAATAATCGGGCCGAAGT
CGATACGCTTTCTCCGGCACAGGCTGCCGAACTGAAACCGATGCCGCAAAGTTGGCGCGGCGTGCTGCCGTGTGCTGATT
GCGAAGGAATCGAAACCTCTCTGTTCCTCGAAAAAGACGGAACCTGGGTGATGAATGAGCGTTATCTGGGGGCTCGTGAA
GAACCTTCCTCCTTCGCTTCCTACGGTACATGGGCGCGAACCGCTGACAAGCTGGTATTAACCGATAGCAAAGGTGAAAA
GTCATATTATCGCGCGAAAGGAGATGCGCTGGAGATGCTCGATCGTGAAGGTAATCCGATTGAATCGCAGTTCAACTATA
CGCTGGAACCGGCACAATCCAGCTTACCCATGACACCGATGACCCTGCGGGGCATGTATTTTTATATGGCTGATGCGGCG
ACCTTCACTGATTGCGCGACCGGAAAACGTTTCATGGTGGCGAATAACGCAGAGCTGGAGCGTGGCTACCTGGCTGCGCG
CGGTAACAGTGAAAAACCGGTGTTACTGTCAGTAGAAGGTCACTTTACGCTTGAGGCTAATCCGGATACCGGTGCGCCGA
CCAAAGTATTAGCGCCCGATACGGCAGGTAAATTTTACCCAAACCAGGATTGCAGTAGTTTGGGGCTGTAA