Detailed information of regulator


Summary

Regulator ID REG0273 experimental
Regulator type protein
Regulatory pathway (from literatures) TCS-RR
KEGG pathway (determined by BlastKOALA) Two-component system (map02020); Cationic antimicrobial peptide (CAMP) resistance (map01503)
Related T6SS T6SS00937 experimental (Type i1)
Strain Escherichia coli RS218
Replicon chromosome
Sequence Protein sequence (233 a.a.); Nucleotide sequence (699 bp)
Description CpxR protein directly binds the hcp2B promoter region.Use E.coli RS218 as DE719 gene annotation.
Reference

External database links

Locus tag (Gene) W817_21870 (CpxR)
Coordinates (Strand) 4360812..4361510 (-)
NCBI ID 446956464
RefSeq NZ_CP007149
Uniprot ID L3PSR5_ECOLX, A0A0E2KY66_ECOU3, Q1R406_ECOUT, A0A0H2Z5Q0_ECOK1, A0A061YIR2_ECOLX, B7MI45_ECO45, A0A192CEB7_ECOLX
KEGG ID ecz:ECS88_4362, eci:UTI89_C4496, ecv:APECO1_2556
KEGG pathway (determined by BlastKOALA) map02020; map01503
PDB ID -

  Target
Target Regulation (↓/↑) Target sequence
hcp2B promoter AGCTTATGTAATCGTGTTCTGAAATTGACTAAAAATATATTTAAACACCATAAAAGAGTTTTTCGGTAGGT The putative CpxR binding site is indicated with red color

Pfam domain hit(s) of regulator

Domain Pfam ID E-value Aligned region
Response_reg PF00072.26 5.2e-29 4..112
Trans_reg_C PF00486.30 1.3e-21 152..228

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-232 MNKILLVDDDRELTSLLKELLEMEGFNVIVAHDGEQALDLLDDSIDLLLLDVMMPKKNGIDTLKALRQTHQTPVIMLTARGSELDRVLGLELGADDYLPKPFNDRELVARIRAILRRSHWSEQQQNNDNGSPTLEVDALSLNPGRQEATFDGQTLELTGTEFTLLYLLAQHLGQVVSREHLSQEVLGKRLTPFDRAIDMHISNLRRKLPDRKDGHPWFKTLRGRGYLMVSAS



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9980 - -



  Protein sequence of regulator: 233 a.a.    .

>REG0273 NZ_CP007149:c4361510-4360812 [Escherichia coli RS218]
MNKILLVDDDRELTSLLKELLEMEGFNVIVAHDGEQALDLLDDSIDLLLLDVMMPKKNGIDTLKALRQTHQTPVIMLTAR
GSELDRVLGLELGADDYLPKPFNDRELVARIRAILRRSHWSEQQQNNDNGSPTLEVDALSLNPGRQEATFDGQTLELTGT
EFTLLYLLAQHLGQVVSREHLSQEVLGKRLTPFDRAIDMHISNLRRKLPDRKDGHPWFKTLRGRGYLMVSAS*

  Nucleotide sequence of regulator: 699 bp    .

>REG0273 NZ_CP007149:c4361510-4360812 [Escherichia coli RS218]
ATGAATAAAATCCTGTTAGTTGATGATGACCGAGAGCTGACTTCCCTATTAAAGGAGCTGCTCGAGATGGAAGGCTTCAA
CGTGATTGTTGCCCACGATGGGGAACAGGCGCTTGATCTTCTGGACGACAGCATTGATTTACTTTTGCTTGATGTAATGA
TGCCGAAGAAAAATGGTATCGACACATTAAAAGCACTTCGCCAGACACACCAGACGCCTGTCATTATGTTGACGGCGCGC
GGCAGTGAACTTGATCGCGTTCTCGGCCTTGAGCTGGGCGCAGATGACTATCTCCCAAAACCGTTTAATGATCGTGAGCT
GGTGGCACGTATTCGCGCGATCCTGCGCCGTTCGCACTGGAGCGAACAACAGCAAAACAACGACAACGGTTCACCGACAC
TGGAAGTTGATGCCTTAAGTCTCAATCCTGGTCGCCAGGAAGCCACCTTCGACGGGCAAACACTGGAGTTAACCGGTACT
GAGTTTACCCTGCTCTATTTGCTGGCACAGCATCTGGGTCAGGTGGTTTCCCGTGAGCATTTAAGCCAGGAAGTGCTGGG
CAAGCGCCTGACGCCTTTCGACCGCGCTATCGATATGCATATTTCCAACCTGCGTCGTAAACTGCCGGATCGTAAAGATG
GTCACCCGTGGTTTAAAACCTTGCGTGGTCGCGGCTATCTGATGGTTTCTGCTTCATGA