Detailed information of regulator


Summary

Regulator ID REG0270 experimental
Regulator type protein
Regulatory pathway (from literatures) Transcription regulator
KEGG pathway (determined by BlastKOALA) -
Related T6SS T6SS00904 experimental (Type i2)
Strain Escherichia coli strain ExPEC XM
Replicon chromosome
Sequence Protein sequence (149 a.a.); Nucleotide sequence (447 bp)
Description Fur directly suppressed the expression of hcp1 clusters through binding directly on the promotor of T6SS1 in the iron replete condition.
Reference

External database links

Locus tag (Gene) CXG97_03740 (Fur)
Coordinates (Strand) 729474..729920 (-)
NCBI ID 446053847
RefSeq NZ_CP025328
Uniprot ID A0A0E0Y275_ECO1C, S1PU11_ECOLX, S1EU97_ECOLX, L3QCZ0_ECOLX, L4JEM8_ECOLX, U9XEA5_ECOLX, U9XMU0_ECOLX, V0SEL7_ECOLX, U9Z797_ECOLX, V0UHX9_ECOLX, V0XSD8_ECOLX, V0YEN0_ECOLX, U9ZKF7_ECOLX, A0A0E2L7T8_ECOU3, A0A080J9N9_ECOLX, A0A0A0F9M7_ECOLX, FUR_ECOL6, A0A2T3RWP1_9ESCH, D3GXD5_ECO44, Q32IP1_SHIDS, E3PH77_ECOH1, A7ZJ68_ECO24, A0A0E1T3G9_ECOLX, Q1REN4_ECOUT, A0A0H2YX47_ECOK1, B1LLC7_ECOSM, A0A140NE13_ECOBD, A0A0H3PSJ7_ECO5C, B1EK62_ESCAT, D6I6Q9_ECOLX, D6J7Z7_ECOLX, A0A1X3JTQ8_9ESCH, F4NLS6_ECOLX, A0A2S7SP25_ESCFE, E0J1S2_ECOLW, A0A168XF98_KLEOX, B7UKW4_ECO27, B7MFV0_ECO45, B7LKT0_ESCF3, B7L9M0_ECO55, B7N9S9_ECOLU, A0A0H3MEC8_ECO7I, B7MPI8_ECO81, A0A1Q8NB34_SHIDY, A0A0H7UAJ9_SHISO, A0A1X3JKL5_ECOLX, A0A1X3L6Q9_ECOLX, F4VBA2_ECOLX, A0A1X3I973_ECOLX, A0A0K9TEK7_ECOLX, F4SW14_ECOLX, F4TBP4_ECOLX, A0A1X3LGH2_ECOLX, A0A1X3LUX6_ECOLX, A0A1X3J5F0_ECOLX, E9XNY3_ECOLX, E6BKX3_ECOLX, E1IR72_ECOLX, E1J1I7_ECOLX, D8EDV9_ECOLX, A0A0H3EH26_ECO8N, A0A0E1LUJ9_ECOLX, D8A8A1_ECOMS, D7XXD9_ECOLX, D7Y974_ECOM1, E9TNB1_ECOLX, I4SMJ0_ECOLX, FUR_ECOLI, FUR_ECO57, I2UM10_ECOLX, I2WQK1_ECOLX, A0A192CIN2_ECOLX, F0JLI7_ESCFE
KEGG ID ecz:ECS88_0719, esl:O3K_18225, eci:UTI89_C0687, eco:b0683, ecq:ECED1_0664, elh:ETEC_0700, ecm:EcSMS35_0705, ebd:ECBD_2978, ecc:c0770, sdy:SDY_0623, eln:NRG857_03085, ect:ECIAI39_0640, elw:ECW_m0735, ecv:APECO1_1381, ecw:EcE24377A_0711, ece:Z0831, eum:ECUMN_0768, ecj:JW0669, elo:EC042_0711, eck:EC55989_0669, ecg:E2348C_0574, ecs:ECs0714, efe:EFER_2426
KEGG pathway (determined by BlastKOALA) -
PDB ID 2FU4

  Target
Target Regulation (↓/↑) Target sequence
T6SS1 (TssB) promotor TTGTATATTTTCCTCATCATCATTGCTTTTTATTTAAATCATCCGATAATCCCCTGAATATAATTATGTTAATAACCATCAGAAAAAGTGGATGATGAGGAAAAGGAT Fur box predicted are indicated in red

Pfam domain hit(s) of regulator

Domain Pfam ID E-value Aligned region
FUR PF01475.21 1.4e-49 10..130

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Inside 1-148 MTDNNTALKKAGLKVTLPRLKILEVLQEPDNHHVSAEDLYKRLIDMGEEIGLATVYRVLNQFDDAGIVTRHNFEGGKSVFELTQQHHHDHLICLDCGKVIEFSDDSIEARQREIAAKHGIRLTNHSLYLYGHCAEGDCREDEHAHEGK



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9976 - -



  Protein sequence of regulator: 149 a.a.    .

>REG0270 NZ_CP025328:c729920-729474 [Escherichia coli]
MTDNNTALKKAGLKVTLPRLKILEVLQEPDNHHVSAEDLYKRLIDMGEEIGLATVYRVLNQFDDAGIVTRHNFEGGKSVF
ELTQQHHHDHLICLDCGKVIEFSDDSIEARQREIAAKHGIRLTNHSLYLYGHCAEGDCREDEHAHEGK*

  Nucleotide sequence of regulator: 447 bp    .

>REG0270 NZ_CP025328:c729920-729474 [Escherichia coli]
ATGACTGATAACAATACCGCCCTAAAGAAAGCTGGCCTGAAAGTAACGCTTCCTCGCTTGAAAATCCTGGAAGTTCTTCA
GGAGCCGGACAACCATCACGTCAGTGCGGAAGATTTATACAAACGTCTGATCGATATGGGTGAAGAAATTGGTCTGGCTA
CGGTATATCGCGTACTGAACCAGTTTGACGACGCTGGTATCGTCACCCGCCACAATTTTGAAGGCGGTAAATCCGTATTT
GAACTAACACAGCAACATCACCACGATCACCTGATCTGCCTCGACTGCGGTAAGGTTATCGAATTTAGTGATGATTCCAT
CGAAGCGCGTCAGCGTGAAATCGCCGCAAAACATGGCATTCGCCTGACTAACCACAGTCTCTATCTTTACGGTCACTGTG
CCGAAGGCGATTGCCGCGAAGATGAGCACGCGCACGAAGGCAAATAA