Detailed information of regulator


Summary

Regulator ID REG0251 experimental
Regulator type protein
Regulatory pathway (from literatures) Global regulator
KEGG pathway (determined by BlastKOALA) -
Related T6SS T6SS00464 experimental (Type i4b)
Strain Escherichia coli 042
Replicon chromosome
Sequence Protein sequence (149 a.a.); Nucleotide sequence (447 bp)
Description The P4532-lacZ translational fusion is responsive to iron limitation and Fur and the P4532 promoter is repressed by the 194 Fur transcriptional regulator in an iron-dependent manner and EMSA shows Fur binds to the P4532 promoter and limits access to the RNA polymerase; EMSA shows Fur bound to the sci1 promoter,yielding two bands due to the presence of two Fur boxes
Reference

External database links

Locus tag (Gene) EC042_RS03685 (Fur)
Coordinates (Strand) 786918..787364 (-)
NCBI ID 446053847
RefSeq NC_017626
Uniprot ID FUR_ECO57, FUR_ECOL6, FUR_ECOLI, A0A023YTP1_ECOLR, A0A026V745_ECOLX, A0A028A3D9_ECOLX, A0A028DLS2_ECOLX, A0A029I9Z0_ECOLX, A0A029IZE4_ECOLX, A0A069XDS3_ECOLX, A0A070F8S9_ECOLX, A0A070SKU6_ECOLX, A0A070UT53_ECOLX, A0A073G191_ECOLX, A0A073HN13_ECOLX, A0A073UP01_ECOLX, A0A074I5N6_ECOLX, A0A080G832_ECOLX, A0A080J9N9_ECOLX, A0A0A0F9M7_ECOLX, A0A0E0TUU5_ECOLX, A0A0E0V333_ECOLX, A0A0E0Y275_ECO1C, A0A0E1LUJ9_ECOLX, A0A0E1T3G9_ECOLX, A0A0E2L7T8_ECOU3, A0A0H2YX47_ECOK1, A0A0H3EH26_ECO8N, A0A0H3MEC8_ECO7I, A0A0H3PSJ7_ECO5C, A0A0H7UAJ9_SHISO, A0A0K9TEK7_ECOLX, A0A140NE13_ECOBD, A0A168XF98_KLEOX, A0A192CIN2_ECOLX, A0A1Q8NB34_SHIDY, A0A1X3I973_ECOLX, A0A1X3IS24_ECOLX, A0A1X3J5F0_ECOLX, A0A1X3JKL5_ECOLX, A0A1X3JTQ8_9ESCH, A0A1X3K9F4_ECOLX, A0A1X3L6Q9_ECOLX, A0A1X3LGH2_ECOLX, A0A1X3LUX6_ECOLX, A0A1Z3UTC1_ECOLX, A0A2D0NNF7_ECOLX, A0A2S7SP25_ESCFE, A0A2T3RWP1_9ESCH, A7ZJ68_ECO24, B1EK62_ESCAT, B1LLC7_ECOSM, B6HYP3_ECOSE, B7L9M0_ECO55, B7LKT0_ESCF3, B7MFV0_ECO45, B7MPI8_ECO81, B7N9S9_ECOLU, B7UKW4_ECO27, C8UJY8_ECO1A, D3GXD5_ECO44, D3QMM1_ECOCB, D6HTP6_ECOLX, D6I6Q9_ECOLX, D6J7Z7_ECOLX, D7XER2_ECOLX, D7XXD9_ECOLX, D7Y974_ECOM1, D7ZJ17_ECOLX, D8A8A1_ECOMS, D8EDV9_ECOLX, E0J1S2_ECOLW, E1IR72_ECOLX, E1J1I7_ECOLX, E3PH77_ECOH1, E3XJ20_ECOLX, E6BKX3_ECOLX, E9TNB1_ECOLX, E9XNY3_ECOLX, F0JLI7_ESCFE, F4NLS6_ECOLX, F4SKN9_ECOLX, F4SW14_ECOLX, F4TBP4_ECOLX, F4VBA2_ECOLX, G0FEF8_ECOLX, H4INF2_ECOLX, H4J534_ECOLX, H4L8V6_ECOLX, I2RQC1_ECOLX, I2SYC3_ECOLX, I2UM10_ECOLX, I2WQK1_ECOLX, I2X7S9_ECOLX, I4SMJ0_ECOLX, J7RR56_ECOLX, K4V318_ECOLX, L3BQK0_ECOLX, L3PC61_ECOLX, L3QCZ0_ECOLX, L4JEM8_ECOLX, L4VZ59_ECOLX, M9FYP0_ECOLX, Q1REN4_ECOUT, Q32IP1_SHIDS, S0Y0T6_ECOLX, S0ZJZ9_ECOLX, S1DGG5_ECOLX, S1EU97_ECOLX, S1HG28_ECOLX, S1IH10_ECOLX, S1IHF7_ECOLX, S1PU11_ECOLX, T6MA28_ECOLX, T9EUV6_ECOLX, T9T2A7_ECOLX, U9XEA5_ECOLX, U9XMU0_ECOLX, U9YNB1_ECOLX, U9Z797_ECOLX, U9ZKF7_ECOLX, V0SEL7_ECOLX, V0UHX9_ECOLX, V0XSD8_ECOLX, V0YEN0_ECOLX, V6FRL1_ECOLX, V8KIZ0_ECOLX, W0AKV1_9ESCH, W8ZEV5_ECOLX
KEGG ID ecz:ECS88_0719, eal:EAKF1_ch0779, eci:UTI89_C0687, eco:b0683, elh:ETEC_0700, ecq:ECED1_0664, ebd:ECBD_2978, ecc:c0770, sdy:SDY_0623, eln:NRG857_03085, ecy:ECSE_0745, ect:ECIAI39_0640, elw:ECW_m0735, eoi:ECO111_0702, ecos:EC958_0801, eum:ECUMN_0768, eck:EC55989_0669, efe:EFER_2426, esl:O3K_18225, ecm:EcSMS35_0705, eok:G2583_0844, ecv:APECO1_1381, ecw:EcE24377A_0711, eoc:CE10_0673, ece:Z0831, eun:UMNK88_720, ecj:JW0669, elo:EC042_0711, ecg:E2348C_0574, ecs:ECs0714
KEGG pathway (determined by BlastKOALA) -
PDB ID 2FU4

  Target
Target Regulation (↓/↑) Target sequence
EC042_4532 promoter gcgaatatcccatggagcagcaggcacaaattattgctgatcattttactttgcaggctgaaggatacgggacatggtgtgatatgagaagggacggtgatatcacactggacggaaatatgtctgagtatgttattcgcagcctgtataccagcacgttgcgggggttcccatg The red sequences indicate Fur binding boxes and GATC Dam methylation sites are indicated in bold blue letters
EC042_4524 (TssB) promotor cctgattatttgcattatatcgatcgatgtatctgttatattgagatttttcagatcttcgtcctataatgatcaaaattaaatcagtgcacaaggggaggcatctgcggtgatggaacccctgagatgcaggtttcacaggagagagccatg The red sequences indicate Fur binding boxes and GATC Dam methylation sites are indicated in bold blue letters

Pfam domain hit(s) of regulator

Domain Pfam ID E-value Aligned region
FUR PF01475.21 1.4e-49 10..130

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Inside 1-148 MTDNNTALKKAGLKVTLPRLKILEVLQEPDNHHVSAEDLYKRLIDMGEEIGLATVYRVLNQFDDAGIVTRHNFEGGKSVFELTQQHHHDHLICLDCGKVIEFSDDSIEARQREIAAKHGIRLTNHSLYLYGHCAEGDCREDEHAHEGK



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9976 - -



  Protein sequence of regulator: 149 a.a.    .

>REG0251 NC_017626:c787364-786918 [Escherichia coli 042]
MTDNNTALKKAGLKVTLPRLKILEVLQEPDNHHVSAEDLYKRLIDMGEEIGLATVYRVLNQFDDAGIVTRHNFEGGKSVF
ELTQQHHHDHLICLDCGKVIEFSDDSIEARQREIAAKHGIRLTNHSLYLYGHCAEGDCREDEHAHEGK*

  Nucleotide sequence of regulator: 447 bp    .

>REG0251 NC_017626:c787364-786918 [Escherichia coli 042]
ATGACTGATAACAATACCGCCCTAAAGAAAGCTGGCCTGAAAGTAACGCTTCCTCGTTTAAAAATCCTGGAAGTTCTTCA
GGAGCCGGACAACCATCACGTCAGTGCGGAAGATTTATACAAACGTCTGATCGATATGGGTGAAGAAATTGGTCTGGCTA
CGGTATATCGCGTACTGAACCAGTTTGACGACGCTGGTATCGTCACCCGCCACAATTTTGAAGGCGGTAAATCCGTATTT
GAACTGACACAGCAACATCACCACGATCACCTGATCTGCCTCGACTGCGGCAAGGTTATCGAATTTAGTGATGATTCCAT
CGAAGCGCGTCAGCGTGAAATTGCCGCAAAACATGGCATTCGCCTGACTAACCACAGTCTCTATCTTTACGGTCACTGTG
CCGAAGGCGATTGCCGCGAAGATGAGCACGCGCACGAAGGCAAATAA