Detailed information of regulator


Summary

Regulator ID REG0250 experimental
Regulator type protein
Regulatory pathway (from literatures) Global regulator
KEGG pathway (determined by BlastKOALA) -
Related T6SS T6SS00464 experimental (Type i4b)
Strain Escherichia coli 042
Replicon chromosome
Sequence Protein sequence (138 a.a.); Nucleotide sequence (414 bp)
Description PaggR::lacZ reporter plasmids were introduced into an E. coli K12 hns mutant in the presence (pBADaggR) and in the absence (pBAD33) of AggR and further analysis suggested that the H-NS-dependent zone of repression lies downstream of the transcription start site (+114 to +290) as deletion of this DNA fragment eliminated dependence on H-NS.
Reference

External database links

Locus tag (Gene) EC042_RS06800 (Hns)
Coordinates (Strand) 1376831..1377244 (-)
NCBI ID 447210122
RefSeq NC_017626
Uniprot ID HNS_ECO57, HNS_ECOL6, HNS_ECOLI, HNS_SHIFL, A0A023YVU6_ECOLR, A0A026V807_ECOLX, A0A029I4E5_ECOLX, A0A029IXS2_ECOLX, A0A069XI11_ECOLX, A0A070FHP1_ECOLX, A0A070SJI3_ECOLX, A0A070UZG2_ECOLX, A0A073G9U7_ECOLX, A0A073HK63_ECOLX, A0A073UK86_ECOLX, A0A074I6J0_ECOLX, A0A080G791_ECOLX, A0A080J190_ECOLX, A0A090B484_ECO57, A0A090BZR8_ECOLX, A0A0A0F9S4_ECOLX, A0A0E0TX43_ECOLX, A0A0E0V573_ECOLX, A0A0E0Y0E5_ECO1C, A0A0E1LWR3_ECOLX, A0A0E1SRU9_ECOLX, A0A0E2L702_ECOU3, A0A0H2YYE1_ECOK1, A0A0H3EJ00_ECO8N, A0A0H3MG90_ECO7I, A0A0H3PNM3_ECO5C, A0A0H7VBX7_SHISO, A0A0K9T7Q1_ECOLX, A0A140NCH9_ECOBD, A0A163Y654_KLEOX, A0A192CMC6_ECOLX, A0A1S9KFY8_SHIDY, A0A1W2MMX0_SHIFL, A0A1X3I9L5_ECOLX, A0A1X3IPV4_ECOLX, A0A1X3J146_ECOLX, A0A1X3JJB2_ECOLX, A0A1X3KEK0_ECOLX, A0A1X3L589_ECOLX, A0A1X3LIQ7_ECOLX, A0A1X3LWY5_ECOLX, A0A1Z3V3P7_ECOLX, A0A2D0P7X1_ECOLX, A7ZL10_ECO24, B1LH64_ECOSM, B6I9V2_ECOSE, B7LHI0_ECO55, B7MKY9_ECO45, B7MU23_ECO81, B7N450_ECOLU, B7UQC9_ECO27, D3H2L9_ECO44, D3QR08_ECOCB, D6HVV4_ECOLX, D6I752_ECOLX, D6J9K8_ECOLX, D7X1G2_ECOLX, D7XMK7_ECOLX, D7Y5Q5_ECOM1, D7ZJE5_ECOLX, D8ACN8_ECOMS, D8E2X7_ECOLX, E0IV23_ECOLW, E1IMZ1_ECOLX, E1J912_ECOLX, E3PKM4_ECOH1, E3XMS1_ECOLX, E6BLQ4_ECOLX, E9TEY2_ECOLX, E9XM74_ECOLX, E9YZL5_ECOLX, F4NGY0_ECOLX, F4SGV7_ECOLX, F4TDD1_ECOLX, F4VBR7_ECOLX, G0FD56_ECOLX, H4IQH0_ECOLX, H4J6W0_ECOLX, H4LAX4_ECOLX, I2RNV9_ECOLX, I2RV33_ECOLX, I2T0V9_ECOLX, I2WMZ9_ECOLX, I2XH53_ECOLX, J7RQM6_ECOLX, L3CDP9_ECOLX, L3P8J2_ECOLX, L3Q903_ECOLX, L4JBG0_ECOLX, L4VWU9_ECOLX, M9GBT6_ECOLX, Q1RCK0_ECOUT, Q32GW9_SHIDS, S0XN41_ECOLX, S0YR53_ECOLX, S1DY87_ECOLX, S1EMQ0_ECOLX, S1GYK7_ECOLX, S1I0A0_ECOLX, S1IR71_ECOLX, S1PGU9_ECOLX, T6M000_ECOLX, T9D3S6_ECOLX, T9STD5_ECOLX, U9YIC2_ECOLX, U9YV92_ECOLX, U9YYQ0_ECOLX, U9ZPF1_ECOLX, V0B017_ECOLX, V0STJ3_ECOLX, V0VFV5_ECOLX, V0Y7Q8_ECOLX, V0ZC62_ECOLX, V6G374_ECOLX, V8JMY5_ECOLX, W8ZH67_ECOLX
KEGG ID ecq:ECED1_1388, elh:ETEC_1341, ecc:c1701, ect:ECIAI39_1572, elw:ECW_m1329, ecj:JW1225, eci:UTI89_C1434, elo:EC042_1292, ecos:EC958_1510, ecv:APECO1_351, eok:G2583_1511, eck:EC55989_1332, ecw:EcE24377A_1386, eco:b1237, ecz:ECS88_1305, ecm:EcSMS35_1904, eun:UMNK88_1555, ebd:ECBD_2385, ecs:ECs1739, sfl:SF1237, ecy:ECSE_1287, ecg:E2348C_1364, esl:O3K_14465, eln:NRG857_06355, eoc:CE10_1414, ece:Z2013, sdy:SDY_1289, sft:NCTC1_01307, sfx:S1323, eum:ECUMN_1536
KEGG pathway (determined by BlastKOALA) -
PDB ID 1NI8, 1LR1, 2MW2, 1HNS, 1HNR

  Target
Target Regulation (↓/↑) Target sequence
EC042_RS26480 (aggR) promoter ATTAACAAACGTATTTTATATGAGTTAAAAATATATCTTTTTATTGATAAGAGTTAGGTCATTCTAACGCAGATTGCCTGATAAAGACATTTTTTTCATGTGAGAATGATATGAAATTAAAACAAAACATCGAAAAAGA

Pfam domain hit(s) of regulator

Domain Pfam ID E-value Aligned region
Histone_HNS PF00816.23 4.8e-19 33..127

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-137 MSEALKILNNIRTLRAQARECTLETLEEMLEKLEVVVNERREEESAAAAEVEERTRKLQQYREMLIADGIDPNELLNSLAAVKSGTKAKRAQRPAKYSYVDENGETKTWTGQGRTPAVIKKAMDEQGKSLDDFLIKQ



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9965 - -



  Protein sequence of regulator: 138 a.a.    .

>REG0250 NC_017626:c1377244-1376831 [Escherichia coli 042]
MSEALKILNNIRTLRAQARECTLETLEEMLEKLEVVVNERREEESAAAAEVEERTRKLQQYREMLIADGIDPNELLNSLA
AVKSGTKAKRAQRPAKYSYVDENGETKTWTGQGRTPAVIKKAMDEQGKSLDDFLIKQ*

  Nucleotide sequence of regulator: 414 bp    .

>REG0250 NC_017626:c1377244-1376831 [Escherichia coli 042]
ATGAGCGAAGCACTTAAAATTCTGAACAACATCCGTACTCTTCGTGCGCAGGCAAGAGAATGTACACTTGAAACGCTGGA
AGAAATGCTGGAAAAATTAGAAGTTGTTGTTAACGAACGTCGCGAAGAAGAAAGCGCGGCTGCTGCTGAAGTTGAAGAGC
GCACTCGTAAACTGCAGCAATATCGCGAAATGCTGATCGCTGACGGTATTGACCCGAACGAACTGCTGAATAGCCTTGCT
GCCGTTAAATCTGGCACCAAAGCTAAACGTGCTCAGCGTCCGGCAAAATATAGCTACGTTGACGAAAACGGCGAAACTAA
AACCTGGACTGGCCAGGGCCGTACTCCAGCTGTAATCAAAAAAGCAATGGATGAGCAAGGTAAATCCCTCGACGATTTCC
TGATCAAGCAATAA