Detailed information of regulator


Summary

Regulator ID REG0246 experimental
Regulator type protein
Regulatory pathway (from literatures) QS regulatory pathway
KEGG pathway (determined by BlastKOALA) -
Related T6SS T6SS00372 experimental (Type i4b)
Strain Edwardsiella tarda EIB202
Replicon chromosome
Sequence Protein sequence (224 a.a.); Nucleotide sequence (672 bp)
Description FabR activates T3/T6SS production through esrB in E. piscicida
Reference

External database links

Locus tag (Gene) ETAE_3474 (fabR)
Coordinates (Strand) 3666488..3667159 (-)
NCBI ID 502613311
RefSeq NC_013508
Uniprot ID D0ZHB2_EDWTE, A0A0H3DX53_EDWTF
KEGG ID etr:ETAE_3474, etd:ETAF_3136
KEGG pathway (determined by BlastKOALA) -
PDB ID -

  Target
Target Regulation (↓/↑) Target sequence
Unknown -

Pfam domain hit(s) of regulator

Domain Pfam ID E-value Aligned region
TetR_N PF00440.25 1.8e-07 16..58

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-223 MGVRAQQKERTRRSLIEAAFNQLSAERSFASLSLREVSREAGIAPTSFYRHFRDVDELGLTMVDESGLMLRQLMRQARQRIAKGGSVIRTSVATFMEFIGNNPNAFRLLLRERSGTSAAFRAAVQREIQHFIAELADYLEIENHMPRSFTEAQAEAMVTIVFSAGAEALDIDSEQRRQLEERLVLQLRMISKGVYYWYRREQEKAHLAQVAASAIDGGHHQKS



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9463 - -



  Protein sequence of regulator: 224 a.a.    .

>REG0246 NC_013508:c3667159-3666488 [Edwardsiella tarda EIB202]
MGVRAQQKERTRRSLIEAAFNQLSAERSFASLSLREVSREAGIAPTSFYRHFRDVDELGLTMVDESGLMLRQLMRQARQR
IAKGGSVIRTSVATFMEFIGNNPNAFRLLLRERSGTSAAFRAAVQREIQHFIAELADYLEIENHMPRSFTEAQAEAMVTI
VFSAGAEALDIDSEQRRQLEERLVLQLRMISKGVYYWYRREQEKAHLAQVAASAIDGGHHQKS*

  Nucleotide sequence of regulator: 672 bp    .

>REG0246 NC_013508:c3667159-3666488 [Edwardsiella tarda EIB202]
ATGGGCGTCAGGGCACAGCAAAAGGAACGGACTCGCCGTTCACTGATTGAGGCGGCATTTAATCAGCTCAGCGCCGAGCG
CAGCTTCGCCAGCCTGAGCCTGCGAGAGGTTTCGCGCGAGGCGGGGATCGCGCCCACGTCGTTTTATCGCCATTTTCGCG
ATGTGGATGAGCTGGGGCTCACCATGGTGGACGAAAGCGGCCTGATGCTGCGTCAGCTGATGCGTCAGGCGCGCCAGCGT
ATCGCGAAGGGCGGTAGCGTGATCCGTACCTCGGTCGCGACCTTCATGGAGTTTATTGGTAATAATCCCAATGCGTTTCG
TTTGCTGCTGCGTGAGCGTTCGGGCACCTCGGCGGCCTTTCGCGCCGCGGTACAGCGTGAAATTCAGCATTTTATTGCGG
AACTTGCCGACTATCTGGAAATCGAAAATCACATGCCGCGCAGTTTTACAGAAGCGCAGGCCGAGGCGATGGTCACCATT
GTGTTCAGCGCGGGCGCCGAGGCGTTGGATATCGACAGTGAGCAACGCCGTCAGCTAGAGGAGCGCCTGGTGCTGCAGCT
GCGGATGATTTCCAAAGGCGTGTACTACTGGTATCGTCGCGAACAGGAGAAAGCGCACCTTGCGCAGGTCGCCGCGTCGG
CCATCGACGGCGGACACCATCAAAAGTCATAG