Detailed information of regulator


Summary

Regulator ID REG0242 experimental
Regulator type protein
Regulatory pathway (from literatures) TCS regulatory pathway
KEGG pathway (determined by BlastKOALA) -
Related T6SS T6SS00372 experimental (Type i4b)
Strain Edwardsiella tarda EIB202
Replicon chromosome
Sequence Protein sequence (513 a.a.); Nucleotide sequence (1539 bp)
Description MviN mediates the regulation of osmotic pressure on esrB transcription. The deletion of mviN slightly increased the productions of T3/T6SS (EseB/C/D), while the over-expression of mviN significantly decreased those proteins' yield
Reference

External database links

Locus tag (Gene) ETAE_1425 (mviN)
Coordinates (Strand) 1535368..1536906 (+)
NCBI ID 502611288
RefSeq NC_013508
Uniprot ID D0ZGZ0_EDWTE, A0A0H3DS91_EDWTF
KEGG ID etr:ETAE_1425, etd:ETAF_1320
KEGG pathway (determined by BlastKOALA) -
PDB ID -

  Target
Target Regulation (↓/↑) Target sequence
ETAE_0886 (esrB) promoter -

Pfam domain hit(s) of regulator

Domain Pfam ID E-value Aligned region
MurJ PF03023.16 3.7e-152 28..477

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-25 MNLLKSLAAVSSMTLFSRVLGFARD
Transmembrane helix 26-45 ALVARIFGAGMATDAFFVAF
Inside 46-87 KLPNLLRRIFAEGAFSQAFVPILAEYKNQQGEQATQTFIAYV
Transmembrane helix 88-110 SGLLTLILALVTLLGMLAAPWVI
Outside 111-129 YATAPGFADTPDKFALTSA
Transmembrane helix 130-152 LLRITFPYILLISLASMAGAVLN
Inside 153-158 TWNRFS
Transmembrane helix 159-181 VPAFAPTLLNVSMIGFALFVAPY
Outside 182-185 CHPP
Transmembrane helix 186-203 ILALAWAVLVGGVLQLGY
Inside 204-235 QLPHLKKIGMLVLPRLNLHDRGVWRVLKLMGP
Transmembrane helix 236-258 AIVGVSVSQISLIINTIFASFLV
Outside 259-272 SGSVSWMYYADRLM
Transmembrane helix 273-295 ELPSGVLGVALGTILLPSLAKSF
Inside 296-314 SSGRLDDYNRLLDWGLRLC
Transmembrane helix 315-337 FLLALPCAVALGVIAKPLTVALF
Outside 338-351 QYGKFSAFDAAMTQ
Transmembrane helix 352-374 RALVAYSIGLLGIIMVKILAPGF
Inside 375-385 YSRQDIKTPVK
Transmembrane helix 386-403 IAIVTLILTQVMNLIFIG
Outside 404-406 PLK
Transmembrane helix 407-429 HAGLSLSIGLAACLNAGLLYWQL
Inside 430-441 RRQRLFTPQKGW
Transmembrane helix 442-464 LGFLGKLVLAVLVMTAVLIGMMW
Outside 465-478 LMPAWDIGNMPYRL
Transmembrane helix 479-501 LRLVGLVVAGAVSYFAVLALLGF
Inside 502-512 RLRDFTRSAVL



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.8331 - -



  Protein sequence of regulator: 513 a.a.    .

>REG0242 NC_013508:1535368-1536906 [Edwardsiella tarda EIB202]
MNLLKSLAAVSSMTLFSRVLGFARDALVARIFGAGMATDAFFVAFKLPNLLRRIFAEGAFSQAFVPILAEYKNQQGEQAT
QTFIAYVSGLLTLILALVTLLGMLAAPWVIYATAPGFADTPDKFALTSALLRITFPYILLISLASMAGAVLNTWNRFSVP
AFAPTLLNVSMIGFALFVAPYCHPPILALAWAVLVGGVLQLGYQLPHLKKIGMLVLPRLNLHDRGVWRVLKLMGPAIVGV
SVSQISLIINTIFASFLVSGSVSWMYYADRLMELPSGVLGVALGTILLPSLAKSFSSGRLDDYNRLLDWGLRLCFLLALP
CAVALGVIAKPLTVALFQYGKFSAFDAAMTQRALVAYSIGLLGIIMVKILAPGFYSRQDIKTPVKIAIVTLILTQVMNLI
FIGPLKHAGLSLSIGLAACLNAGLLYWQLRRQRLFTPQKGWLGFLGKLVLAVLVMTAVLIGMMWLMPAWDIGNMPYRLLR
LVGLVVAGAVSYFAVLALLGFRLRDFTRSAVL*

  Nucleotide sequence of regulator: 1539 bp    .

>REG0242 NC_013508:1535368-1536906 [Edwardsiella tarda EIB202]
ATGAATCTACTTAAATCACTGGCTGCGGTCAGCTCAATGACCCTCTTTTCGCGCGTGCTGGGGTTTGCCCGCGACGCGCT
GGTCGCCAGGATCTTTGGCGCTGGGATGGCGACCGATGCCTTTTTTGTGGCCTTCAAGCTGCCCAACCTGCTACGGCGGA
TCTTTGCCGAGGGCGCCTTTTCCCAGGCCTTTGTGCCGATCCTGGCGGAGTATAAAAACCAGCAGGGCGAGCAGGCGACG
CAGACCTTTATCGCCTACGTCAGCGGTCTATTGACCCTGATTTTGGCGCTGGTGACGCTGCTCGGTATGCTGGCGGCCCC
CTGGGTTATCTATGCCACCGCGCCCGGCTTCGCCGATACGCCGGACAAGTTTGCGCTGACCAGCGCGCTGCTGCGCATCA
CCTTTCCCTATATCTTGCTCATCTCCTTGGCCTCGATGGCCGGCGCGGTGCTGAATACCTGGAACCGTTTTTCGGTACCG
GCCTTTGCGCCGACGCTGCTGAACGTCAGCATGATCGGCTTTGCGCTGTTTGTGGCGCCGTACTGCCATCCGCCGATCCT
GGCGCTGGCCTGGGCCGTGCTGGTGGGTGGCGTGCTGCAGCTGGGGTATCAGCTGCCGCACCTGAAGAAGATAGGCATGC
TGGTGCTGCCGCGCCTCAACCTGCACGATCGCGGGGTATGGCGGGTGCTCAAGCTGATGGGGCCGGCGATTGTCGGGGTT
TCTGTCAGCCAAATCTCGCTGATCATCAATACTATTTTCGCCTCTTTCCTGGTCTCGGGCTCCGTTTCCTGGATGTACTA
TGCCGACCGCCTGATGGAGCTGCCGTCGGGGGTGCTGGGGGTCGCGCTGGGGACGATTCTGCTGCCGTCGCTGGCCAAAA
GCTTCTCCTCTGGCCGCTTGGACGACTATAACCGTCTGCTGGACTGGGGGCTGCGCCTCTGCTTTCTGCTGGCGCTGCCC
TGCGCCGTGGCGCTGGGAGTGATCGCGAAGCCGCTGACGGTGGCGCTGTTCCAGTATGGTAAATTCAGCGCCTTTGATGC
GGCGATGACCCAGCGAGCGCTGGTGGCCTACTCCATCGGCCTGCTCGGGATTATCATGGTGAAGATCCTGGCGCCGGGCT
TTTACTCTCGCCAGGATATCAAGACGCCGGTGAAGATCGCCATCGTCACGCTGATCCTGACCCAGGTGATGAACCTGATC
TTTATCGGTCCCCTAAAGCATGCCGGGCTGTCGCTCTCCATCGGCCTGGCCGCCTGCCTGAATGCCGGTCTGCTGTACTG
GCAGCTGCGGCGTCAGCGTCTGTTCACGCCGCAGAAGGGGTGGTTGGGATTCCTGGGTAAGCTGGTGCTGGCGGTGCTGG
TGATGACGGCGGTGCTGATCGGCATGATGTGGCTGATGCCGGCGTGGGATATCGGAAATATGCCTTATCGCCTGCTGCGT
CTGGTGGGGCTGGTGGTGGCCGGCGCGGTCAGCTACTTTGCGGTGCTGGCGCTGCTGGGATTCCGCCTGCGCGACTTTAC
CCGCAGCGCGGTGCTATAA