Detailed information of regulator


Summary

Regulator ID REG0239 experimental
Regulator type protein
Regulatory pathway (from literatures) TCS regulatory pathway
KEGG pathway (determined by BlastKOALA) Aminoacyl-tRNA biosynthesis (map00970)
Related T6SS T6SS00372 experimental (Type i4b)
Strain Edwardsiella tarda EIB202
Replicon chromosome
Sequence Protein sequence (861 a.a.); Nucleotide sequence (2583 bp)
Description Putative activators of esrB as identified by Tn-seq.
Reference

External database links

Locus tag (Gene) ETAE_2638 (leuS)
Coordinates (Strand) 2776570..2779152 (+)
NCBI ID 502612492
RefSeq NC_013508
Uniprot ID D0ZCD4_EDWTE, A0A0H3DSR5_EDWTF
KEGG ID etd:ETAF_2377, etr:ETAE_2638
KEGG pathway (determined by BlastKOALA) map00970
PDB ID -

  Target
Target Regulation (↓/↑) Target sequence
ETAE_0886 (esrB) promoter -

Pfam domain hit(s) of regulator

Domain Pfam ID E-value Aligned region
tRNA-synt_1_2 PF13603.8 1.1e-78 221..403
tRNA-synt_1 PF00133.24 3.5e-27 14..171
Anticodon_1 PF08264.15 2.3e-15 700..821
tRNA-synt_1 PF00133.24 2.5e-07 417..572
tRNA-synt_1 PF00133.24 1.3e-06 618..653

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-860 MQEQYRPEDIESHVQRHWDEQKTFQVTEDDSKEKYYCLSMLPYPSGRLHMGHVRNYTIGDVISRYQRMLGKNVLQPIGWDAFGLPAEGAAVKNNTAPAPWTYANIDYMKNQLKLLGFGYDWSREIATCKPDYYRWEQWFFTKLYEKGLVYKKTSAVNWCPNDQTVLANEQVIDGCCWRCDSKVERKEIPQWFIKITDYADQLLNDLDKLEDWPEQVKTMQRNWIGRSEGVEITFRVADRDDTFAVYTTRPDTFMGVSYLAIAAAHPLAQQAAANNPALAQFIDECKNTKVAEADMATMEKKGMATGLYAIHPLSGERLPIWVANFVLMDYGTGAVMSVPAHDQRDWEFAAKYHLPMKPVILAADGQAPDISAAAMTDKGVLFNSGEFDGLDFSAAFDAVANRLIAAGVGERKVNYRLRDWGVSRQRYWGAPIPMVTLEDGSVIPTPEDQLPVILPEDVVMNGITSPLKADPAWAKTTVNGQPALRETDTFDTFMESSWYYARYTCPQYDQGMLDPQAANYWLPVDQYVGGIEHAIMHLMYFRFFHKLMRDAGLVDSDEPAKRLLCQGMVLADAFYYTGANGERNWVSPVDVIVERDDKGRITKATDRDGRELVYAGMSKMSKSKNNGIDPQVMVERYGADTVRLFMMFASPAEMTLEWQESGVEGANRFLKRVWKLAFDHQQKGPTVALDLTALNDDQKALRRDLHKTIAKVSDDIGRRQTFNTAIAAVMELMNKLTRAPQESEQDRALMQEALLAVVRMLYPFTPHVCFTLWSALGGVGDIDVAPWPVADDAAMVEDSKLIVVQVNGKVRGKITVAADASEEQVRALAAQEPLVAKYLDGVTVRKVIFVPGKLLNLVVG



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9905 - -



  Protein sequence of regulator: 861 a.a.    .

>REG0239 NC_013508:2776570-2779152 [Edwardsiella tarda EIB202]
MQEQYRPEDIESHVQRHWDEQKTFQVTEDDSKEKYYCLSMLPYPSGRLHMGHVRNYTIGDVISRYQRMLGKNVLQPIGWD
AFGLPAEGAAVKNNTAPAPWTYANIDYMKNQLKLLGFGYDWSREIATCKPDYYRWEQWFFTKLYEKGLVYKKTSAVNWCP
NDQTVLANEQVIDGCCWRCDSKVERKEIPQWFIKITDYADQLLNDLDKLEDWPEQVKTMQRNWIGRSEGVEITFRVADRD
DTFAVYTTRPDTFMGVSYLAIAAAHPLAQQAAANNPALAQFIDECKNTKVAEADMATMEKKGMATGLYAIHPLSGERLPI
WVANFVLMDYGTGAVMSVPAHDQRDWEFAAKYHLPMKPVILAADGQAPDISAAAMTDKGVLFNSGEFDGLDFSAAFDAVA
NRLIAAGVGERKVNYRLRDWGVSRQRYWGAPIPMVTLEDGSVIPTPEDQLPVILPEDVVMNGITSPLKADPAWAKTTVNG
QPALRETDTFDTFMESSWYYARYTCPQYDQGMLDPQAANYWLPVDQYVGGIEHAIMHLMYFRFFHKLMRDAGLVDSDEPA
KRLLCQGMVLADAFYYTGANGERNWVSPVDVIVERDDKGRITKATDRDGRELVYAGMSKMSKSKNNGIDPQVMVERYGAD
TVRLFMMFASPAEMTLEWQESGVEGANRFLKRVWKLAFDHQQKGPTVALDLTALNDDQKALRRDLHKTIAKVSDDIGRRQ
TFNTAIAAVMELMNKLTRAPQESEQDRALMQEALLAVVRMLYPFTPHVCFTLWSALGGVGDIDVAPWPVADDAAMVEDSK
LIVVQVNGKVRGKITVAADASEEQVRALAAQEPLVAKYLDGVTVRKVIFVPGKLLNLVVG*

  Nucleotide sequence of regulator: 2583 bp    .

>REG0239 NC_013508:2776570-2779152 [Edwardsiella tarda EIB202]
ATGCAAGAGCAATATCGTCCAGAGGACATTGAATCCCACGTCCAGCGCCATTGGGATGAACAGAAAACCTTCCAGGTCAC
CGAAGATGACAGCAAAGAGAAATACTATTGCCTCTCCATGCTGCCGTATCCCTCCGGCCGACTGCATATGGGCCACGTCC
GTAACTACACCATCGGTGATGTGATTTCCCGTTACCAGCGCATGCTGGGCAAAAACGTGCTACAACCCATCGGCTGGGAC
GCCTTCGGCCTGCCGGCAGAGGGCGCGGCGGTGAAGAACAACACCGCGCCGGCCCCCTGGACCTATGCCAACATCGATTA
CATGAAGAACCAGCTGAAGCTGCTGGGCTTCGGCTACGACTGGAGCCGCGAAATCGCCACCTGTAAGCCGGATTACTACC
GCTGGGAACAGTGGTTCTTCACCAAGCTGTATGAAAAGGGTCTGGTCTATAAGAAGACCTCTGCGGTCAACTGGTGCCCG
AACGATCAGACCGTGCTGGCCAACGAGCAGGTCATCGACGGCTGCTGCTGGCGCTGCGACTCCAAGGTCGAGCGCAAAGA
GATCCCGCAGTGGTTTATCAAGATCACCGACTACGCCGATCAGCTGCTCAACGACCTCGACAAGCTGGAAGACTGGCCGG
AGCAGGTTAAGACCATGCAACGCAACTGGATCGGCCGCTCTGAAGGGGTAGAGATCACCTTCCGCGTCGCCGATCGCGAC
GACACCTTCGCCGTCTACACCACCCGCCCGGACACCTTCATGGGCGTCAGCTACCTGGCGATCGCCGCCGCGCACCCGCT
GGCCCAACAGGCCGCCGCCAACAACCCGGCGCTGGCGCAGTTCATCGACGAGTGCAAGAACACCAAGGTTGCCGAGGCTG
ACATGGCGACCATGGAGAAGAAAGGCATGGCCACCGGCCTGTACGCCATCCACCCGCTGAGCGGCGAACGCCTGCCTATC
TGGGTCGCCAACTTTGTGCTGATGGACTACGGCACCGGTGCGGTGATGTCCGTTCCGGCCCACGACCAGCGCGACTGGGA
GTTCGCCGCCAAGTACCACCTGCCGATGAAGCCGGTGATCCTGGCCGCCGACGGCCAGGCGCCGGACATCAGCGCCGCCG
CCATGACCGACAAGGGCGTGCTGTTCAACTCCGGCGAATTTGACGGTCTGGACTTCAGCGCCGCCTTCGACGCCGTCGCC
AACCGCCTGATCGCCGCCGGCGTCGGCGAACGCAAGGTAAACTACCGCCTGCGCGACTGGGGGGTTTCCCGCCAGCGTTA
CTGGGGCGCACCGATCCCGATGGTGACCCTGGAAGACGGCAGCGTGATCCCGACGCCGGAAGACCAGCTGCCGGTGATCC
TGCCGGAGGACGTGGTCATGAACGGCATCACCAGCCCGCTCAAGGCCGATCCGGCCTGGGCGAAGACCACCGTTAACGGT
CAGCCGGCGCTGCGCGAAACCGACACCTTCGACACCTTCATGGAGTCCTCCTGGTACTATGCGCGCTACACCTGCCCGCA
GTACGATCAGGGGATGCTGGATCCGCAGGCCGCCAACTACTGGCTGCCGGTCGATCAGTACGTCGGCGGTATCGAGCACG
CCATCATGCACCTGATGTACTTCCGCTTCTTCCACAAGCTGATGCGTGACGCGGGCCTGGTGGACTCCGACGAGCCGGCC
AAGCGCCTGCTGTGCCAGGGCATGGTGCTGGCGGACGCCTTCTACTACACCGGCGCCAACGGCGAGCGTAACTGGGTCTC
TCCGGTGGATGTCATCGTAGAGCGCGACGACAAGGGCCGCATCACCAAGGCGACCGACCGCGACGGCCGCGAGCTGGTCT
ACGCCGGCATGAGCAAGATGTCCAAGTCGAAGAACAACGGCATCGACCCGCAGGTGATGGTAGAGCGCTACGGCGCCGAC
ACCGTACGCCTGTTCATGATGTTCGCCTCCCCGGCGGAAATGACCCTGGAGTGGCAGGAGTCCGGCGTTGAGGGGGCCAA
CCGCTTCCTGAAGCGCGTCTGGAAACTGGCGTTCGATCACCAGCAGAAAGGGCCGACCGTCGCGCTCGACCTGACGGCGC
TGAACGATGACCAAAAAGCCCTGCGCCGCGATCTGCACAAGACCATCGCCAAGGTGAGCGACGACATCGGTCGCCGTCAG
ACCTTCAACACCGCCATCGCCGCCGTGATGGAGCTGATGAACAAGCTGACCCGCGCCCCGCAGGAGAGCGAGCAGGATCG
CGCCCTGATGCAGGAAGCCCTGCTGGCCGTGGTGCGCATGCTGTATCCGTTTACCCCGCACGTCTGCTTCACCCTGTGGA
GCGCGCTGGGCGGCGTGGGCGACATCGACGTCGCGCCGTGGCCGGTCGCCGATGACGCGGCGATGGTCGAAGATAGCAAG
CTGATCGTGGTACAGGTCAACGGCAAGGTGCGCGGTAAGATCACCGTTGCCGCCGACGCCAGCGAGGAGCAGGTGCGCGC
GCTGGCGGCGCAGGAGCCGCTGGTCGCTAAGTACCTCGACGGGGTCACCGTACGCAAGGTGATCTTTGTGCCGGGCAAAC
TGCTCAACCTGGTTGTCGGGTGA