SecReT6, T6SS database

Detailed information of regulator

Summary

Regulator ID	REG0234
Regulator type	protein
Regulatory pathway (from literatures)	TCS regulatory pathway
KEGG pathway (determined by BlastKOALA)	-
Related T6SS	T6SS00372 (Type i4b)
Strain	Edwardsiella tarda EIB202
Replicon	chromosome
Sequence	Protein sequence (48 a.a.); Nucleotide sequence (144 bp)
Description	Putative activators of esrB as identified by Tn-seq.
Reference	[1] Yin K, Guan Y, Ma R, et al. Critical role for a promoter discriminator in RpoS control of virulence in Edwardsiella piscicida. PLoS Pathog. 2018 Aug 31;14(8):e1007272. doi: 10.1371/journal.ppat.1007272. eCollection 2018 Aug. PMID: 30169545

External database links

Locus tag (Gene)	ETAE_1170
Coordinates (Strand)	1271304..1271447 (-)
NCBI ID	267984186
GenBank	CP001135
Uniprot ID	D0ZFI3_EDWTE
KEGG ID	etr:ETAE_1170
KEGG pathway (determined by BlastKOALA)	-
PDB ID	-

Target

Loading, please wait

Target	Regulation (↓/↑)	Target sequence
ETAE_0886 (esrB) promoter	↓	-

Showing 1 to 1 of 1 rows

Pfam domain hit(s) of regulator

Loading, please wait

Domain	Pfam ID	E-value	Aligned region
No matching records found

Transmembrane helices

Transmembrane helices are predicted using TMHMM 2.0 software.

Loading, please wait

Prediction	Region	Sequence
Inside	1-20	MTATNYNKLEYTCKNNDSMM
Transmembrane helix	21-38	FGFNFVLLFINTVSSKQF
Outside	39-47	SSCRDPGRM

Signal peptides

Signal peptides and corresponding cleavage sites are predicted using SignalP 5.0 software.

Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).

Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).

Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).

Loading, please wait

Prediction	Probability	Cleavage site	Signal peptide sequence
Other	0.9279	-	-

Protein sequence of regulator: 48 a.a. .

                                    >REG0234 CP001135:c1271447-1271304 [Edwardsiella tarda EIB202]
MTATNYNKLEYTCKNNDSMMFGFNFVLLFINTVSSKQFSSCRDPGRM*

Nucleotide sequence of regulator: 144 bp .

                                    >REG0234 CP001135:c1271447-1271304 [Edwardsiella tarda EIB202]
ATGACTGCAACAAATTATAATAAGTTGGAATATACCTGTAAAAATAACGATAGCATGATGTTTGGATTCAATTTTGTCCT
ATTATTTATAAATACTGTTTCTTCTAAACAATTTTCTTCTTGTAGAGATCCTGGTCGCATGTGA

                                