Detailed information of regulator


Summary

Regulator ID REG0231 experimental
Regulator type protein
Regulatory pathway (from literatures) TCS regulatory pathway
KEGG pathway (determined by BlastKOALA) -
Related T6SS T6SS00372 experimental (Type i4b)
Strain Edwardsiella tarda EIB202
Replicon chromosome
Sequence Protein sequence (391 a.a.); Nucleotide sequence (1173 bp)
Description Putative activators of esrB as identified by Tn-seq.
Reference

External database links

Locus tag (Gene) ETAE_1158
Coordinates (Strand) 1257412..1258584 (+)
NCBI ID 502611022
RefSeq NC_013508
Uniprot ID D0ZFG9_EDWTE, A0A0H3DP76_EDWTF
KEGG ID etr:ETAE_1156, etd:ETAF_1079
KEGG pathway (determined by BlastKOALA) -
PDB ID -

  Target
Target Regulation (↓/↑) Target sequence
ETAE_0886 (esrB) promoter -

Pfam domain hit(s) of regulator

Domain Pfam ID E-value Aligned region
DUF418 PF04235.14 3e-40 227..384

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Inside 1-20 MAEMPVAAQRGRAPRIAALD
Transmembrane helix 21-40 ALRGLALLGILLMNIVGFAL
Outside 41-59 PKAAYLNPAYQGIPSAWDQ
Transmembrane helix 60-82 GVWLLLSLTVQGKFLALFALLFG
Inside 83-94 AGLQLQLPRGGR
Transmembrane helix 95-114 WIQARLGWLMLFGLLHTLLL
Outside 115-118 WDGD
Transmembrane helix 119-135 ILLVYGLIGLMCWRTIR
Inside 136-141 DADSAR
Transmembrane helix 142-164 ALLYRGATLYAVGLGMLLLLAAM
Outside 165-210 SRAEPHGFWQVGYAEIQYETYWKLRGGVEAWRNRSELLISNLLALA
Transmembrane helix 211-233 VQYGWQLCGVMLLGAGLMRCGWL
Inside 234-244 RGRFSSAHYRR
Transmembrane helix 245-267 CGAGLLLSGLALQALGSGLQWYL
Outside 268-276 RWDFRWCGY
Transmembrane helix 277-299 LLQLPGELAAPLMMLGYVALIYA
Inside 300-319 AWPRLSRWRLTAALQRVGRM
Transmembrane helix 320-339 ALSNYLLQTLICTTLFYRWG
Outside 340-348 LFNHAGRAA
Transmembrane helix 349-371 LLLWVPPVWGGCLLFATLWLRVF
Inside 372-390 RQGPVEWLWRRLTGLSLRV



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9621 - -



  Protein sequence of regulator: 391 a.a.    .

>REG0231 NC_013508:1257412-1258584 [Edwardsiella tarda EIB202]
MAEMPVAAQRGRAPRIAALDALRGLALLGILLMNIVGFALPKAAYLNPAYQGIPSAWDQGVWLLLSLTVQGKFLALFALL
FGAGLQLQLPRGGRWIQARLGWLMLFGLLHTLLLWDGDILLVYGLIGLMCWRTIRDADSARALLYRGATLYAVGLGMLLL
LAAMSRAEPHGFWQVGYAEIQYETYWKLRGGVEAWRNRSELLISNLLALAVQYGWQLCGVMLLGAGLMRCGWLRGRFSSA
HYRRCGAGLLLSGLALQALGSGLQWYLRWDFRWCGYLLQLPGELAAPLMMLGYVALIYAAWPRLSRWRLTAALQRVGRMA
LSNYLLQTLICTTLFYRWGLFNHAGRAALLLWVPPVWGGCLLFATLWLRVFRQGPVEWLWRRLTGLSLRV*

  Nucleotide sequence of regulator: 1173 bp    .

>REG0231 NC_013508:1257412-1258584 [Edwardsiella tarda EIB202]
ATGGCCGAGATGCCTGTGGCGGCGCAGCGGGGACGAGCGCCCCGGATCGCGGCGCTGGATGCCCTGCGCGGCCTCGCGCT
GCTGGGGATCCTGCTGATGAATATCGTCGGCTTTGCCCTGCCAAAGGCGGCGTACCTGAACCCCGCCTATCAGGGGATCC
CCTCCGCCTGGGATCAGGGGGTATGGCTGCTGCTCAGCCTGACGGTGCAGGGCAAGTTTCTGGCCCTGTTCGCGCTGCTG
TTCGGCGCTGGCCTGCAGCTACAGCTGCCGCGCGGCGGGCGCTGGATCCAGGCGCGTTTGGGATGGCTGATGCTGTTTGG
GCTGCTGCATACCCTGCTGCTGTGGGATGGCGACATTCTCCTGGTCTATGGCCTGATCGGCCTGATGTGCTGGCGGACGA
TCCGCGACGCCGATTCGGCCCGCGCTCTGCTGTACCGCGGGGCGACGCTGTATGCCGTCGGGCTGGGGATGCTGCTGCTG
CTGGCCGCGATGAGCCGCGCGGAGCCACACGGCTTTTGGCAGGTCGGCTATGCCGAGATCCAGTATGAGACCTACTGGAA
GCTGCGCGGGGGCGTCGAGGCCTGGCGTAACCGCAGCGAGCTGTTGATAAGCAATCTGCTGGCGCTGGCGGTGCAGTATG
GCTGGCAGCTGTGCGGCGTGATGCTGCTGGGCGCGGGACTGATGCGCTGCGGTTGGCTGCGCGGCCGCTTTTCCTCTGCC
CACTACCGGCGCTGCGGGGCCGGGCTGCTGCTGAGCGGGCTGGCGCTTCAGGCGCTGGGCAGTGGTCTGCAGTGGTATCT
GCGCTGGGACTTTCGCTGGTGCGGCTACCTGCTACAGCTGCCCGGTGAGCTGGCGGCGCCGCTGATGATGCTGGGCTATG
TGGCGCTGATCTACGCCGCTTGGCCGCGCCTGTCGCGCTGGCGGCTGACCGCCGCGCTGCAGCGGGTTGGGCGTATGGCC
CTGAGCAACTATCTGCTGCAGACGCTGATCTGCACTACGCTGTTTTATCGATGGGGGCTATTCAATCACGCCGGGCGCGC
GGCGCTGCTGCTGTGGGTGCCGCCGGTGTGGGGGGGCTGTCTGCTGTTTGCGACGCTCTGGCTGCGCGTCTTCCGTCAGG
GGCCCGTAGAGTGGCTGTGGCGCCGTCTGACCGGACTGTCTCTGCGCGTCTGA