Detailed information of regulator


Summary

Regulator ID REG0220 experimental
Regulator type protein
Regulatory pathway (from literatures) TCS regulatory pathway
KEGG pathway (determined by BlastKOALA) Metabolic pathways (map01100); Biosynthesis of secondary metabolites (map01110); Purine metabolism (map00230); Drug metabolism - other enzymes (map00983)
Related T6SS T6SS00372 experimental (Type i4b)
Strain Edwardsiella tarda EIB202
Replicon chromosome
Sequence Protein sequence (489 a.a.); Nucleotide sequence (1467 bp)
Description Putative repressors of esrB as identified by Tn-seq.
Reference

External database links

Locus tag (Gene) ETAE_2787 (guaB)
Coordinates (Strand) 2925310..2926776 (-)
NCBI ID 502612646
RefSeq NC_013508
Uniprot ID D0ZD58_EDWTE, A0A0H3DVH3_EDWTF
KEGG ID etd:ETAF_2526, etr:ETAE_2787
KEGG pathway (determined by BlastKOALA) map01100; map01110; map00230; map00983
PDB ID -

  Target
Target Regulation (↓/↑) Target sequence
ETAE_0886 (esrB) promoter -

Pfam domain hit(s) of regulator

Domain Pfam ID E-value Aligned region
IMPDH PF00478.27 2.6e-160 8..473

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-488 MLRIVKEALTFDDVLLVPAHSTVLPNTAELGTQLTATIRLNIPMLSAAMDTVTEARLAIALAQEGGIGFIHKNMSIERQADEVRRVKKHESGVVTDPQTVTPSTTLREVKALTERNGFAGYPVVTEDNQLVGIITGRDVRFVTDLEQPVTAVMTPKERLVTVKEGEARDVVLQRMHEKRVEKALVVDDSFHLRGMITVKDFQKAERKPNACKDEHGRLRVGAAVGAGAGNEERIAALVEAGVDVLLIDSSHGHSEGVLQRIRETRAKFPQLQIIGGNVATAAGAKALADAGVNAVKVGIGPGSICTTRIVTGVGVPQITAVSDAVAALEGTGIPVIADGGIRFSGDIAKALAAGAACVMVGSMLAGTEESPGEIELYQGRSFKSYRGMGSLGAMSKGSSDRYFQSDNAADKLVPEGIEGRVAYKGRLKEIVHQQMGGLRSCMGLTGCATIDELRTKAQFVRITGSGIQESHVHDVTITKESPNYRLGS



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9757 - -



  Protein sequence of regulator: 489 a.a.    .

>REG0220 NC_013508:c2926776-2925310 [Edwardsiella tarda EIB202]
MLRIVKEALTFDDVLLVPAHSTVLPNTAELGTQLTATIRLNIPMLSAAMDTVTEARLAIALAQEGGIGFIHKNMSIERQA
DEVRRVKKHESGVVTDPQTVTPSTTLREVKALTERNGFAGYPVVTEDNQLVGIITGRDVRFVTDLEQPVTAVMTPKERLV
TVKEGEARDVVLQRMHEKRVEKALVVDDSFHLRGMITVKDFQKAERKPNACKDEHGRLRVGAAVGAGAGNEERIAALVEA
GVDVLLIDSSHGHSEGVLQRIRETRAKFPQLQIIGGNVATAAGAKALADAGVNAVKVGIGPGSICTTRIVTGVGVPQITA
VSDAVAALEGTGIPVIADGGIRFSGDIAKALAAGAACVMVGSMLAGTEESPGEIELYQGRSFKSYRGMGSLGAMSKGSSD
RYFQSDNAADKLVPEGIEGRVAYKGRLKEIVHQQMGGLRSCMGLTGCATIDELRTKAQFVRITGSGIQESHVHDVTITKE
SPNYRLGS*

  Nucleotide sequence of regulator: 1467 bp    .

>REG0220 NC_013508:c2926776-2925310 [Edwardsiella tarda EIB202]
ATGCTACGTATTGTTAAAGAAGCCCTGACGTTTGATGACGTTCTCTTAGTTCCTGCCCACTCTACCGTTCTGCCGAACAC
CGCCGAACTTGGCACTCAGCTGACTGCCACTATTCGCCTGAACATTCCTATGCTGTCCGCCGCCATGGACACCGTCACCG
AAGCGCGTCTGGCCATTGCGCTGGCGCAGGAAGGGGGCATTGGCTTTATCCATAAGAACATGTCCATTGAGCGCCAGGCC
GATGAAGTGCGCCGGGTGAAAAAGCACGAATCCGGCGTGGTGACCGACCCGCAGACCGTGACGCCGAGCACCACCCTGCG
CGAAGTGAAGGCCCTGACCGAGCGTAACGGCTTTGCCGGTTACCCGGTGGTGACGGAAGATAACCAGCTGGTGGGGATCA
TCACCGGCCGCGACGTGCGCTTCGTGACGGACCTGGAGCAGCCGGTCACCGCCGTGATGACGCCGAAAGAGCGCCTGGTG
ACGGTGAAAGAGGGCGAAGCCCGCGACGTGGTGCTGCAGCGTATGCACGAAAAGCGCGTTGAGAAGGCCCTGGTGGTGGA
CGATAGCTTCCACCTGCGCGGCATGATCACCGTGAAAGATTTCCAGAAGGCCGAGCGCAAGCCGAACGCCTGTAAGGATG
AGCATGGCCGCCTGCGCGTCGGCGCCGCCGTCGGCGCTGGTGCCGGTAACGAAGAGCGCATCGCCGCGCTGGTCGAGGCC
GGCGTCGATGTGCTGCTGATCGACTCCTCTCACGGTCACTCCGAAGGCGTGCTGCAGCGCATTCGCGAAACCCGCGCTAA
ATTCCCGCAGCTGCAGATCATCGGCGGCAACGTTGCGACGGCCGCCGGCGCCAAGGCGCTGGCCGACGCGGGGGTGAACG
CCGTCAAAGTGGGTATCGGCCCGGGCTCAATCTGTACCACCCGTATCGTGACCGGCGTCGGTGTACCGCAGATCACCGCC
GTCTCTGACGCCGTCGCCGCCCTGGAAGGGACCGGCATTCCGGTGATCGCCGATGGCGGTATCCGCTTCTCCGGCGACAT
CGCCAAAGCGTTGGCCGCCGGTGCCGCCTGCGTCATGGTCGGCTCCATGCTGGCCGGGACCGAAGAGTCCCCGGGGGAAA
TCGAGCTGTACCAGGGGCGCTCCTTCAAGTCCTACCGTGGAATGGGCTCGCTGGGCGCGATGTCTAAGGGCTCCTCCGAC
CGTTACTTCCAGAGCGATAACGCCGCCGATAAACTGGTGCCGGAAGGCATCGAAGGGCGTGTGGCCTATAAAGGCCGCCT
GAAAGAGATCGTACACCAGCAGATGGGCGGCCTGCGCTCCTGCATGGGGCTGACCGGCTGCGCCACCATCGATGAGCTGC
GCACCAAGGCGCAGTTCGTGCGAATCACCGGCTCCGGTATTCAGGAGAGCCACGTGCACGACGTGACCATTACCAAAGAG
TCACCGAATTACCGTCTGGGTTCTTAA