Detailed information of regulator


Summary

Regulator ID REG0217 experimental
Regulator type protein
Regulatory pathway (from literatures) TCS regulatory pathway
KEGG pathway (determined by BlastKOALA) Homologous recombination (map03440)
Related T6SS T6SS00372 experimental (Type i4b)
Strain Edwardsiella tarda EIB202
Replicon chromosome
Sequence Protein sequence (203 a.a.); Nucleotide sequence (609 bp)
Description Putative repressors of esrB as identified by Tn-seq.
Reference

External database links

Locus tag (Gene) ETAE_1439 (ruvA)
Coordinates (Strand) 1550776..1551384 (+)
NCBI ID 502611302
RefSeq NC_013508
Uniprot ID D0ZH04_EDWTE, A0A0H3DPZ9_EDWTF
KEGG ID etr:ETAE_1439, etd:ETAF_1334
KEGG pathway (determined by BlastKOALA) map03440
PDB ID -

  Target
Target Regulation (↓/↑) Target sequence
ETAE_0886 (esrB) promoter -

Pfam domain hit(s) of regulator

Domain Pfam ID E-value Aligned region
RuvA_N PF01330.23 1.7e-20 2..62
HHH_5 PF14520.8 3.8e-17 72..130
RuvA_C PF07499.15 4.3e-12 158..200

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-202 VIGRLRGTILEKQPPQVVLETHGVGYEVQMPMTCFYELPQVGSEAVIFTHFVVREDAQLLYGFNNKQERALFRELIKVNGVGPKLALAILSGMSAQQFVAAVEREEVAALVKLPGVGKKTAERLVVEMKDRFKGLSGDLFTPTDDLPPSTQPQAQADAEGEAVAALIALGYKPQEASRLVNRVTVAGADSETLIRDALRAAL



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9955 - -



  Protein sequence of regulator: 203 a.a.    .

>REG0217 NC_013508:1550776-1551384 [Edwardsiella tarda EIB202]
VIGRLRGTILEKQPPQVVLETHGVGYEVQMPMTCFYELPQVGSEAVIFTHFVVREDAQLLYGFNNKQERALFRELIKVNG
VGPKLALAILSGMSAQQFVAAVEREEVAALVKLPGVGKKTAERLVVEMKDRFKGLSGDLFTPTDDLPPSTQPQAQADAEG
EAVAALIALGYKPQEASRLVNRVTVAGADSETLIRDALRAAL*

  Nucleotide sequence of regulator: 609 bp    .

>REG0217 NC_013508:1550776-1551384 [Edwardsiella tarda EIB202]
GTGATTGGTCGCCTCAGAGGAACTATTCTGGAAAAGCAGCCGCCGCAGGTGGTGCTGGAAACCCACGGCGTCGGCTATGA
GGTGCAGATGCCGATGACCTGCTTTTATGAGCTGCCGCAGGTTGGCAGTGAAGCGGTGATCTTTACCCACTTCGTGGTAC
GCGAAGACGCCCAGCTGCTGTACGGGTTCAACAATAAGCAGGAGCGCGCGCTGTTCCGCGAACTGATCAAGGTCAACGGC
GTCGGGCCCAAGCTGGCGCTGGCGATCCTGTCCGGGATGTCGGCGCAGCAGTTTGTCGCGGCGGTTGAGCGTGAAGAGGT
CGCGGCGCTGGTCAAGCTGCCGGGCGTGGGCAAGAAAACCGCCGAGCGGCTGGTGGTCGAGATGAAGGACCGCTTCAAGG
GGCTGAGCGGCGATCTGTTTACCCCGACGGATGACCTGCCGCCGAGCACCCAACCGCAGGCCCAGGCGGATGCCGAGGGC
GAGGCGGTTGCCGCGCTGATCGCGCTGGGCTACAAGCCACAGGAGGCCAGCCGCCTGGTGAACCGGGTGACGGTGGCCGG
CGCTGACAGTGAAACCCTGATCCGCGACGCGCTGCGCGCGGCGCTGTAA