Detailed information of regulator


Summary

Regulator ID REG0216 experimental
Regulator type protein
Regulatory pathway (from literatures) TCS regulatory pathway
KEGG pathway (determined by BlastKOALA) DNA replication (map03030); Mismatch repair (map03430); Homologous recombination (map03440)
Related T6SS T6SS00372 experimental (Type i4b)
Strain Edwardsiella tarda EIB202
Replicon chromosome
Sequence Protein sequence (345 a.a.); Nucleotide sequence (1035 bp)
Description Putative repressors of esrB as identified by Tn-seq.
Reference

External database links

Locus tag (Gene) ETAE_2640 (holA)
Coordinates (Strand) 2779832..2780866 (+)
NCBI ID 502612494
RefSeq NC_013508
Uniprot ID D0ZCD6_EDWTE, A0A0H3DV05_EDWTF
KEGG ID etd:ETAF_2379, etr:ETAE_2640
KEGG pathway (determined by BlastKOALA) map03030; map03430; map03440
PDB ID -

  Target
Target Regulation (↓/↑) Target sequence
ETAE_0886 (esrB) promoter -

Pfam domain hit(s) of regulator

Domain Pfam ID E-value Aligned region
DNA_pol3_delt_C PF14840.8 8.2e-58 214..337
DNA_pol3_delta PF06144.15 3.6e-40 21..190

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-344 MSRIYPEQLGAQLQDGLRACYFILGNEPLLIQESLDLIRQRARAHGFDEQFSVTLDPHTDWDALFSQSQSMSLFASRQILTLTLPDNGVNAAMGERLSQLAALLHPDLLLLLRGPRLTRTQENAAWYKLLSPQATLVSCQTPEQTQLPRWVANRARQMQLQLDEAALQLLCYCYEGNLLALSQALGRLSLLYPDGRLTLPRVEQAVNDAAHFSPFHWLDAMLAARGKRAWHILNQLRQEGCEPVVLVRTVQRELLLLLQLKSGATQTPLRTLFDKHKVWQNRRPLLTQALQTLSLTQLHQAVALLSQCEQIIKQDFGQSVWPQLESLTLLLCGKTLPESMLHAE



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9936 - -



  Protein sequence of regulator: 345 a.a.    .

>REG0216 NC_013508:2779832-2780866 [Edwardsiella tarda EIB202]
MSRIYPEQLGAQLQDGLRACYFILGNEPLLIQESLDLIRQRARAHGFDEQFSVTLDPHTDWDALFSQSQSMSLFASRQIL
TLTLPDNGVNAAMGERLSQLAALLHPDLLLLLRGPRLTRTQENAAWYKLLSPQATLVSCQTPEQTQLPRWVANRARQMQL
QLDEAALQLLCYCYEGNLLALSQALGRLSLLYPDGRLTLPRVEQAVNDAAHFSPFHWLDAMLAARGKRAWHILNQLRQEG
CEPVVLVRTVQRELLLLLQLKSGATQTPLRTLFDKHKVWQNRRPLLTQALQTLSLTQLHQAVALLSQCEQIIKQDFGQSV
WPQLESLTLLLCGKTLPESMLHAE*

  Nucleotide sequence of regulator: 1035 bp    .

>REG0216 NC_013508:2779832-2780866 [Edwardsiella tarda EIB202]
ATGAGCCGGATTTACCCCGAACAGCTCGGCGCACAGCTGCAGGATGGGCTGCGCGCCTGCTACTTCATTCTGGGCAACGA
GCCGCTGCTGATCCAGGAGAGCCTGGACCTGATCCGCCAGCGCGCCCGCGCCCACGGGTTTGACGAGCAGTTCAGCGTCA
CCCTCGATCCCCACACCGACTGGGATGCGCTGTTCAGTCAGTCCCAGTCGATGAGCCTGTTCGCCAGCCGCCAAATCCTG
ACCCTGACCCTGCCGGACAACGGTGTCAATGCGGCGATGGGCGAACGCCTGAGCCAGCTTGCCGCCCTGCTCCACCCGGA
TCTGCTGCTGCTGCTGCGCGGTCCACGCCTGACCCGTACGCAGGAAAACGCGGCCTGGTATAAACTGCTCAGCCCACAGG
CCACCCTGGTCAGCTGCCAGACGCCGGAGCAGACCCAGCTACCGCGCTGGGTCGCTAACCGCGCGCGCCAAATGCAGCTG
CAGCTCGACGAGGCGGCGCTACAGCTGCTCTGTTACTGCTACGAGGGCAACCTGCTGGCGCTCTCCCAGGCGCTGGGGCG
ACTCTCCCTGCTCTACCCCGACGGACGGCTGACCCTGCCGCGCGTCGAGCAGGCGGTCAACGATGCCGCCCACTTCTCGC
CGTTCCACTGGCTGGACGCCATGCTGGCGGCGCGCGGCAAGCGTGCCTGGCACATTCTGAACCAGCTGCGCCAGGAGGGC
TGCGAACCGGTGGTGCTGGTGCGCACCGTACAGCGCGAGCTGCTGCTGCTGCTGCAGCTCAAGAGTGGCGCGACGCAGAC
GCCCCTGCGCACGCTGTTCGATAAGCATAAGGTGTGGCAAAACCGCCGCCCGCTGCTGACCCAGGCGCTGCAAACCCTAT
CGCTGACCCAACTGCATCAGGCCGTGGCGCTGCTGAGCCAGTGCGAACAGATAATCAAACAGGATTTCGGCCAATCCGTA
TGGCCTCAGCTGGAGTCCCTGACCCTACTACTGTGCGGCAAGACGCTGCCGGAGAGTATGCTGCATGCCGAGTGA